PDB entry 3n1d

View 3n1d on RCSB PDB site
Description: Crystal structure of the complex of type I ribosome inactivating protein with ribose at 1.7A resolution
Class: Hydrolase
Keywords: RIP, RNA N-glycosidase, Plant protein, Ribose, Hydrolase
Deposited on 2010-05-15, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome inactivating protein
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N1D (0-245)
    Domains in SCOPe 2.07: d3n1da_
  • Heterogens: RIP, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n1dA (A:)
    dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
    tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
    prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pssatislenswsglskqiqlaqgnngvfrtptvlvdsggnrvqitnvtsnvvtsniqll
    lntkni