PDB entry 3n1c

View 3n1c on RCSB PDB site
Description: Crystal structure of the phosphofructokinase-2 from Escherichia coli in complex with fructose-6-phosphate
Class: transferase
Keywords: Phosphofructokinases, Pfk-2, Escherichia coli, Glycolysis, Transferase
Deposited on 2010-05-15, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphofructokinase isozyme 2
    Species: Escherichia coli [TaxId:83333]
    Gene: b1723, JW5280, PFK2, pfkB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n1ca_
  • Chain 'B':
    Compound: 6-phosphofructokinase isozyme 2
    Species: Escherichia coli [TaxId:83333]
    Gene: b1723, JW5280, PFK2, pfkB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n1cb_
  • Chain 'C':
    Compound: 6-phosphofructokinase isozyme 2
    Species: Escherichia coli [TaxId:83333]
    Gene: b1723, JW5280, PFK2, pfkB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n1cc_
  • Chain 'D':
    Compound: 6-phosphofructokinase isozyme 2
    Species: Escherichia coli [TaxId:83333]
    Gene: b1723, JW5280, PFK2, pfkB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n1cd_
  • Heterogens: F6P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n1cA (A:)
    mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
    aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
    leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
    ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
    vvpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlnqgtrlcshddt
    qkiyaylsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n1cB (B:)
    mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
    aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
    leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
    ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
    vvpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlnqgtrlcshddt
    qkiyaylsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n1cB (B:)
    mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
    aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
    leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
    ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
    vvpppvksqsgagdsmvgamtlklaenasleemvrfgvaagsaatlrlcshddtqkiyay
    lsr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n1cC (C:)
    mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
    aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
    leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
    ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
    vvpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlnqgtrlcshddt
    qkiyaylsr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n1cD (D:)
    mvriytltlapsldsatitpqiypegklrctapvfepgggginvaraiahlggsataifp
    aggatgehlvslladenvpvatveakdwtrqnlhvhveasgeqyrfvmpgaalnedefrq
    leeqvleiesgailvisgslppgvklekltqlisaaqkqgircivdssgealsaalaign
    ielvkpnqkelsalvnreltqpddvrkaaqeivnsgkakrvvvslgpqgalgvdsenciq
    vvpppvksqstvgagdsmvgamtlklaenasleemvrfgvaagsaatlnqgtrlcshddt
    qkiyaylsr