PDB entry 3n1b

View 3n1b on RCSB PDB site
Description: c-terminal domain of vps54 subunit of the garp complex
Deposited on 2010-05-15, released 2010-07-14
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein 54
    Species: Mus musculus [TaxId:10090]
    Gene: Vps54
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Vacuolar protein sorting-associated protein 54
    Species: Mus musculus [TaxId:10090]
    Gene: Vps54
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n1bA (A:)
    mdqwsmlrhfdhitkdyhdhiaeisaklvaimdslfdkllskyevkapvpspcfrnickq
    mtkmheaifdllpeeqtqmlflrinasyklhlkkqlshlnvindggpqnglvtadvafyt
    gnlqalkglkdldlnmaeiwe
    

    Sequence, based on observed residues (ATOM records):
    >3n1bA (A:)
    dhitkdyhdhiaeisaklvaimdslfdkllskyevkapvpspcfrnickqmtkmheaifd
    llpeeqtqmlflrinasyklhlkkqlshlnvindggpqnglvtadvafytgnlqalkglk
    dldlnmaeiwe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n1bB (B:)
    mdqwsmlrhfdhitkdyhdhiaeisaklvaimdslfdkllskyevkapvpspcfrnickq
    mtkmheaifdllpeeqtqmlflrinasyklhlkkqlshlnvindggpqnglvtadvafyt
    gnlqalkglkdldlnmaeiwe
    

    Sequence, based on observed residues (ATOM records):
    >3n1bB (B:)
    fdhitkdyhdhiaeisaklvaimdslfdkllskyevkapvpspcfrnickqmtkmheaif
    dllpeeqtqmlflrinasyklhlkkqlshlnvindggpqnglvtadvafytgnlqalkgl
    kdldlnmaeiwe