PDB entry 3n19

View 3n19 on RCSB PDB site
Description: XenA - reduced
Class: oxidoreductase
Keywords: FMN, flavin, oxidoreductase
Deposited on 2010-05-15, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.201
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Xenobiotic reductase A
    Species: Pseudomonas putida [TaxId:303]
    Gene: xenA
    Database cross-references and differences (RAF-indexed):
    • PDB 3N19
    Domains in SCOPe 2.07: d3n19b_
  • Chain 'D':
    Compound: Xenobiotic reductase A
    Species: Pseudomonas putida [TaxId:303]
    Gene: xenA
    Database cross-references and differences (RAF-indexed):
    • PDB 3N19
    Domains in SCOPe 2.07: d3n19d_
  • Heterogens: FNR, SO4, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n19B (B:)
    msalfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatav
    apegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhia
    addtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfa
    hgylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgr
    deqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvts
    awgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle
    ryr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n19B (B:)
    salfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatava
    pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiaa
    ddtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfah
    gylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrd
    eqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvtsa
    wgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n19D (D:)
    msalfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatav
    apegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhia
    addtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfa
    hgylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgr
    deqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvts
    awgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle
    ryr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n19D (D:)
    salfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatava
    pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiaa
    ddtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfah
    gylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrd
    eqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvtsa
    wgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle