PDB entry 3n18

View 3n18 on RCSB PDB site
Description: Crystal stricture of E145G/Y227F chitinase in complex with NAG from Bacillus cereus NCTU2
Deposited on 2010-05-15, released 2010-08-04
The last revision was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase a
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VV09
      • engineered mutation (117)
      • engineered mutation (199)
      • see remark 999 (249)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n18A (A:)
    annlgskllvgywhnfdngtgiiklkdvspkwdvinvsfgetggdrstvefspvygtdad
    fksdisylkskgkkvvlsiggqngvvllpdnaakdrfinsiqslidkygfdgididlgsg
    iylngndtnfknpttpqivnlisairtisdhygpdfllsmapetayvqggysaygsiwga
    ylpiiygvkdkltyihvqhfnagsgigmdgnnynqgtadyevamadmllhgfpvggnann
    ifpalrsdqvmiglpaapaaapsggyisptemkkalnyiikgvpfggkyklsnqsgypaf
    rglmswsinwdaknnfefsnnyrtyfdglslqk
    

    Sequence, based on observed residues (ATOM records):
    >3n18A (A:)
    nlgskllvgywhnfdngtgiiklkdvspkwdvinvsfgetggdrstvefspvygtdadfk
    sdisylkskgkkvvlsiggqngvvllpdnaakdrfinsiqslidkygfdgididlgsgiy
    lngndtnfknpttpqivnlisairtisdhygpdfllsmapetayvqggysaygsiwgayl
    piiygvkdkltyihvqhfnagsgigmdgnnynqgtadyevamadmllhgfpvggnannif
    palrsdqvmiglpaapaaapsggyisptemkkalnyiikgvpfggkyklsnqsgypafrg
    lmswsinwdaknnfefsnnyrtyfdgl