PDB entry 3n16

View 3n16 on RCSB PDB site
Description: xena - y183f
Deposited on 2010-05-15, released 2010-09-22
Made obsolete by 4uth on 2015-08-05

The last revision was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xenobiotic reductase A
    Species: Pseudomonas putida [TaxId:303]
    Gene: xenA
    Database cross-references and differences (RAF-indexed):
    • PDB 3N16
  • Heterogens: SO4, BU3, FMN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n16A (A:)
    msalfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatav
    apegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhia
    addtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfa
    hgflgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgr
    deqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvts
    awgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle
    ryr
    

    Sequence, based on observed residues (ATOM records):
    >3n16A (A:)
    salfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatava
    pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiaa
    ddtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfah
    gflgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrd
    eqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvtsa
    wgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwle