PDB entry 3n14

View 3n14 on RCSB PDB site
Description: XenA - W358A
Class: oxidoreductase
Keywords: Flavin, oxidoreductase, FMN, quinoline
Deposited on 2010-05-15, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xenobiotic reductase A
    Species: Pseudomonas putida [TaxId:303]
    Gene: xenA
    Database cross-references and differences (RAF-indexed):
    • PDB 3N14
    Domains in SCOPe 2.07: d3n14a_
  • Heterogens: FMN, SO4, BU3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n14A (A:)
    msalfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatav
    apegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhia
    addtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfa
    hgylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgr
    deqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvts
    awgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahale
    ryr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n14A (A:)
    salfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatava
    pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiaa
    ddtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfah
    gylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrd
    eqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvtsa
    wgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahale