PDB entry 3n10

View 3n10 on RCSB PDB site
Description: Product complex of adenylate cyclase class IV
Class: lyase
Keywords: cyth domain, antiparallel barrel, product complex, cyclic amp, lyase
Deposited on 2010-05-14, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylate cyclase 2
    Species: Yersinia pestis [TaxId:632]
    Gene: cyaB, y3011, YPO1178, YP_0959
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CH76 (Start-178)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d3n10a_
  • Chain 'B':
    Compound: Adenylate cyclase 2
    Species: Yersinia pestis [TaxId:632]
    Gene: cyaB, y3011, YPO1178, YP_0959
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CH76 (Start-178)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d3n10b_
  • Heterogens: CMP, MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n10A (A:)
    msehfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqism
    vlremnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgk
    fhitvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n10A (A:)
    hfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqismvlr
    emnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkfhi
    tvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n10B (B:)
    msehfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqism
    vlremnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgk
    fhitvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n10B (B:)
    hfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqismvlr
    emnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkfhi
    tvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf