PDB entry 3n0z

View 3n0z on RCSB PDB site
Description: Adenylate cyclase class IV with active site ligand 3AT
Class: lyase
Keywords: CYTH domain, antiparallel barrel, substrate analog complex, LYASE
Deposited on 2010-05-14, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylate cyclase 2
    Species: Yersinia pestis [TaxId:632]
    Gene: cyaB, y3011, YPO1178, YP_0959
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CH76 (Start-178)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d3n0za_
  • Chain 'B':
    Compound: Adenylate cyclase 2
    Species: Yersinia pestis [TaxId:632]
    Gene: cyaB, y3011, YPO1178, YP_0959
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CH76 (Start-178)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d3n0zb_
  • Heterogens: 3AT, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n0zA (A:)
    msehfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqism
    vlremnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgk
    fhitvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0zA (A:)
    fvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqismvlre
    mnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkfhit
    vdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n0zB (B:)
    msehfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqism
    vlremnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgk
    fhitvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0zB (B:)
    hfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdlakqqismvlr
    emnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkfhi
    tvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf