PDB entry 3n0x

View 3n0x on RCSB PDB site
Description: Crystal structure of an ABC-type branched-chain amino acid transporter (RPA4397) from Rhodopseudomonas palustris CGA009 at 1.50 A resolution
Class: transport protein
Keywords: Receptor family ligand binding region, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, TRANSPORT PROTEIN
Deposited on 2010-05-14, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Possible substrate binding protein of ABC transporter system
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA4397
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n0xa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n0xA (A:)
    gaddlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskpdl
    skaalaeayqddgadiaigtsssaaaladlpvaeenkkilivepavadqitgekwnryif
    rtgrnssqdaisnavaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyvpt
    tttdftavgqrlfdalkdkpgkkiiwviwagggdpltklqdmdpkrygielstggnilpa
    laaykrlpgmegatyyyydipknpinewlvtehqkrfnappdfftaggfsaamavvtavq
    kakstdtekliaamegmefdtpkgkmvfrkedhqalqsmyhfkvkvdpavawavlepvre
    lkieemnipiknkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0xA (A:)
    dlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskpdlska
    alaeayqddgadiaigtsssaaaladlpvaeenkkilivepavadqitgekwnryifrtg
    rnssqdaisnavaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyvptttt
    dftavgqrlfdalkdkpgkkiiwviwagggdpltklqdmdpkrygielstggnilpalaa
    ykrlpgmegatyyyydipknpinewlvtehqkrfnappdfftaggfsaamavvtavqkak
    stdtekliaamegmefdtpkgkmvfrkedhqalqsmyhfkvkvdpavawavlepvrelki
    eemnipiknkk