PDB entry 3n0w

View 3n0w on RCSB PDB site
Description: crystal structure of a branched chain amino acid abc transporter periplasmic ligand-binding protein (bxe_c0949) from burkholderia xenovorans lb400 at 1.88 a resolution
Deposited on 2010-05-14, released 2010-06-02
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC branched chain amino acid family transporter, periplasmic ligand binding protein
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: Bxeno_C0896, Bxe_C0949
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ABC branched chain amino acid family transporter, periplasmic ligand binding protein
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: Bxeno_C0896, Bxe_C0949
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n0wA (A:)
    gqstgqvtlgvltdmssvyadsagkgsvaavqlaiedvggkalgqpvklvsadyqmktdv
    alsiarewfdrdgvdaifdvvnsgtalainnlvkdkkklafitaaaadqiggtecngygi
    gflynftsivktvvqaqlakgyktwflmlpdaaygdlmnaairreltagggqivgsvrfp
    fetqdfssyllqakasgaqlivstsggaaninimkqarefglpsktqkvggmidiltdvk
    saglrvmqgqeyatsfywnmddrtrafakrfyakmgkmptnnqaggysaalqylkavnai
    gskdpqkvfaylktikfddavtrhgtlrpggrlvrdmylvrakkpedqkgdwdyydvvat
    igpeqafgplsesrcamdk
    

    Sequence, based on observed residues (ATOM records):
    >3n0wA (A:)
    qvtlgvltdmssvyadsagkgsvaavqlaiedvggkalgqpvklvsadyqmktdvalsia
    rewfdrdgvdaifdvvnsgtalainnlvkdkkklafitaaaadqiggtecngygigflyn
    ftsivktvvqaqlakgyktwflmlpdaaygdlmnaairreltagggqivgsvrfpfetqd
    fssyllqakasgaqlivstsggaaninimkqarefglpsktqkvggmidiltdvksaglr
    vmqgqeyatsfywnmddrtrafakrfyakmgkmptnnqaggysaalqylkavnaigskdp
    qkvfaylktikfddavtrhgtlrpggrlvrdmylvrakkpedqkgdwdyydvvatigpeq
    afgplsesrcamdk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n0wB (B:)
    gqstgqvtlgvltdmssvyadsagkgsvaavqlaiedvggkalgqpvklvsadyqmktdv
    alsiarewfdrdgvdaifdvvnsgtalainnlvkdkkklafitaaaadqiggtecngygi
    gflynftsivktvvqaqlakgyktwflmlpdaaygdlmnaairreltagggqivgsvrfp
    fetqdfssyllqakasgaqlivstsggaaninimkqarefglpsktqkvggmidiltdvk
    saglrvmqgqeyatsfywnmddrtrafakrfyakmgkmptnnqaggysaalqylkavnai
    gskdpqkvfaylktikfddavtrhgtlrpggrlvrdmylvrakkpedqkgdwdyydvvat
    igpeqafgplsesrcamdk
    

    Sequence, based on observed residues (ATOM records):
    >3n0wB (B:)
    qvtlgvltdmssvyadsagkgsvaavqlaiedvggkalgqpvklvsadyqmktdvalsia
    rewfdrdgvdaifdvvnsgtalainnlvkdkkklafitaaaadqiggtecngygigflyn
    ftsivktvvqaqlakgyktwflmlpdaaygdlmnaairreltagggqivgsvrfpfetqd
    fssyllqakasgaqlivstsggaaninimkqarefglpsktqkvggmidiltdvksaglr
    vmqgqeyatsfywnmddrtrafakrfyakmgkmptnnqaggysaalqylkavnaigskdp
    qkvfaylktikfddavtrhgtlrpggrlvrdmylvrakkpedqkgdwdyydvvatigpeq
    afgplsesrcamdk