PDB entry 3n0s

View 3n0s on RCSB PDB site
Description: Crystal structure of BA2930 mutant (H183A) in complex with AcCoA
Class: transferase
Keywords: accoa, 2 acyltransferase, structural genomics, center for structural genomics of infectious diseases, csgid, transferase
Deposited on 2010-05-14, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoglycoside N3-acetyltransferase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Gene: aacC7, BA_2930, GBAA2930, GBAA_2930
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81P86 (3-End)
      • expression tag (1-2)
      • engineered mutation (185)
    Domains in SCOPe 2.07: d3n0sa1, d3n0sa2
  • Chain 'B':
    Compound: Aminoglycoside N3-acetyltransferase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Gene: aacC7, BA_2930, GBAA2930, GBAA_2930
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81P86 (3-End)
      • expression tag (0-2)
      • engineered mutation (185)
    Domains in SCOPe 2.07: d3n0sb1, d3n0sb2
  • Chain 'C':
    Compound: Aminoglycoside N3-acetyltransferase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Gene: aacC7, BA_2930, GBAA2930, GBAA_2930
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81P86 (3-End)
      • expression tag (2)
      • engineered mutation (185)
    Domains in SCOPe 2.07: d3n0sc1, d3n0sc2
  • Chain 'D':
    Compound: Aminoglycoside N3-acetyltransferase
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Gene: aacC7, BA_2930, GBAA2930, GBAA_2930
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81P86 (3-End)
      • expression tag (1-2)
      • engineered mutation (185)
    Domains in SCOPe 2.07: d3n0sd1, d3n0sd2
  • Heterogens: ACO, MG, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n0sA (A:)
    snamndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealme
    viteegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecf
    rtypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgyd
    sntsvalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtm
    gkignakcrlmkqrdivdfgtewfrkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0sA (A:)
    namndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmev
    iteegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfr
    typnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgyds
    ntsvalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmg
    kignakcrlmkqrdivdfgtewfrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n0sB (B:)
    snamndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealme
    viteegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecf
    rtypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgyd
    sntsvalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtm
    gkignakcrlmkqrdivdfgtewfrkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0sB (B:)
    snamndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealme
    viteegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecf
    rtypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgyd
    sntsvalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtm
    gkignakcrlmkqrdivdfgtewfrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n0sC (C:)
    snamndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealme
    viteegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecf
    rtypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgyd
    sntsvalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtm
    gkignakcrlmkqrdivdfgtewfrkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0sC (C:)
    amndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevi
    teegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrt
    ypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsn
    tsvalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgk
    ignakcrlmkqrdivdfgtewfrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n0sD (D:)
    snamndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealme
    viteegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecf
    rtypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgyd
    sntsvalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtm
    gkignakcrlmkqrdivdfgtewfrkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0sD (D:)
    namndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmev
    iteegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfr
    typnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgyds
    ntsvalsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmg
    kignakcrlmkqrdivdfgtewfrk