PDB entry 3n0r

View 3n0r on RCSB PDB site
Description: Structure of the PhyR stress response regulator at 1.25 Angstrom resolution
Deposited on 2010-05-14, released 2010-08-11
The last revision was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.154
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_3477, PhyR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A2S9
      • expression tag (19)
      • engineered mutation (21)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n0rA (A:)
    mgsshhhhhhssglvprgsemhllarlaphlpyirryaraltgdqatgdhyvrvaleala
    agelvldanlsprvalyrvfhaiwlssgaqlevghdqglhagddaaqrlmriaprsrqaf
    lltalegftpteaaqildcdfgeverligdaqaeidaelatevliiedepviaadiealv
    relghdvtdiaatrgealeavtrrtpglvladiqladgssgidavkdilgrmdvpvifit
    afperlltgerpeptflitkpfqpetvkaaigqalffhprrtakaa
    

    Sequence, based on observed residues (ATOM records):
    >3n0rA (A:)
    emhllarlaphlpyirryaraltgdqatgdhyvrvalealaagelvldanlsprvalyrv
    fhaiwlssgaghdqglhagddaaqrlmriaprsrqaflltalegftpteaaqildcdfge
    verligdaqaeidaelatevliiedepviaadiealvrelghdvtdiaatrgealeavtr
    rtpglvladiqladgssgidavkdilgrmdvpvifitafperlltgerpeptflitkpfq
    petvkaaigqalffhprr