PDB entry 3n0q

View 3n0q on RCSB PDB site
Description: crystal structure of a putative aromatic-ring hydroxylating dioxygenase (tm1040_3219) from silicibacter sp. tm1040 at 1.80 a resolution
Deposited on 2010-05-14, released 2010-06-09
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aromatic-ring hydroxylating dioxygenase
    Species: Ruegeria sp. TM1040 [TaxId:292414]
    Gene: benA, TM1040_3219
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FES, NI, CL, TRS, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n0qA (A:)
    gmhsnintlianhraghaldqafytdaevfqtdlqeifykewlfaipaceldkpgsyvth
    qvgnynviivrgadnvirafhnacrhrgsvickakkgnnpklvcpyhqwtyeldgrllwa
    rdmgpdfepsrhglktvhcrelagliyicladeapdferfaevarpylevhdlsnakvah
    essivergnwklvwennrecyhcggnhpalcrtfpddpsvtgieggetpsnlqahfdrce
    qagmpsgfhlsgdgqfrvarmplkegaesytmdgktavrrwlgraafadagsllkfhypt
    twnhflsdhsivfrvtpisptetevttkwlvhkdavegvdydlqrltevwiatndedrev
    vefnqmginspayepgpysptqesgvlqfvewylstlkrnsgphavaae
    

    Sequence, based on observed residues (ATOM records):
    >3n0qA (A:)
    mhsnintlianhraghaldqafytdaevfqtdlqeifykewlfaipaceldkpgsyvthq
    vgnynviivrgadnvirafhnacrhrgsvickakkgnnpklvcpyhqwtyeldgrllwar
    dmgpdfepsrhglktvhcrelagliyicladeapdferfaevarpylevhdlsnakvahe
    ssivergnwklvwennrecyhcggnhpalcrtfpddpsvtgieggetpsnlqahfdrceq
    agmpsgfhlsgdgqfrvarmplkegaesytmdgktavrrwlgraafadagsllkfhyptt
    wnhflsdhsivfrvtpisptetevttkwlvhkdavegvdydlqrltevwiatndedrevv
    efnqmginspayepgpysptqesgvlqfvewylstlkrnsgp