PDB entry 3n0l

View 3n0l on RCSB PDB site
Description: Crystal structure of serine hydroxymethyltransferase from Campylobacter jejuni
Class: transferase
Keywords: Campylobacter, alpha beta class, 3-layer(aba) sandwich, CSGID, Transferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases
Deposited on 2010-05-14, released 2010-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: glyA, Cj0402
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24531 (3-416)
      • expression tag (1-2)
    Domains in SCOPe 2.08: d3n0la1, d3n0la2
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Campylobacter jejuni [TaxId:197]
    Gene: glyA, Cj0402
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24531 (3-416)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3n0lb1, d3n0lb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n0lA (A:)
    snamslemfdkeifdltnkelerqceglemiasenftlpevmevmgsiltnkyaegypgk
    ryyggcefvdeietlaierckklfnckfanvqpnsgsqanqgvyaalinpgdkilgmdls
    hgghlthgakvsssgkmyescfygveldgridyekvreiakkekpklivcgasayarvid
    fakfreiadeigaylfadiahiaglvvagehpspfpyahvvsstthktlrgprggiimtn
    deelakkinsaifpgiqggplmhviaakavgfkfnlsdewkvyakqvrtnaqvlanvlmd
    rkfklvsdgtdnhlvlmsfldrefsgkdadlalgnagitankntvpgeirspfitsglrl
    gtpaltargfkekemeivsnyiadilddvnneklqenikqelkklasnfiiyeramf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0lA (A:)
    namslemfdkeifdltnkelerqceglemiasenftlpevmevmgsiltnkyaegypgkr
    yyggcefvdeietlaierckklfnckfanvqpnsgsqanqgvyaalinpgdkilgmdlkm
    yescfygveldgridyekvreiakkekpklivcgasayarvidfakfreiadeigaylfa
    diahiaglvvagehpspfpyahvvsstthktlrgprggiimtndeelakkinsaifpgiq
    ggplmhviaakavgfkfnlsdewkvyakqvrtnaqvlanvlmdrkfklvsdgtdnhlvlm
    sfldrefsgkdadlalgnagitankntvpgeirspfitsglrlgtpaltargfkekemei
    vsnyiadilddvnneklqenikqelkklasnfiiyeramf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n0lB (B:)
    snamslemfdkeifdltnkelerqceglemiasenftlpevmevmgsiltnkyaegypgk
    ryyggcefvdeietlaierckklfnckfanvqpnsgsqanqgvyaalinpgdkilgmdls
    hgghlthgakvsssgkmyescfygveldgridyekvreiakkekpklivcgasayarvid
    fakfreiadeigaylfadiahiaglvvagehpspfpyahvvsstthktlrgprggiimtn
    deelakkinsaifpgiqggplmhviaakavgfkfnlsdewkvyakqvrtnaqvlanvlmd
    rkfklvsdgtdnhlvlmsfldrefsgkdadlalgnagitankntvpgeirspfitsglrl
    gtpaltargfkekemeivsnyiadilddvnneklqenikqelkklasnfiiyeramf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0lB (B:)
    snamslemfdkeifdltnkelerqceglemiasenftlpevmevmgsiltnkyaegypgk
    ryyggcefvdeietlaierckklfnckfanvqpnsgsqanqgvyaalinpgdkilgmdlk
    myescfygveldgridyekvreiakkekpklivcgasayarvidfakfreiadeigaylf
    adiahiaglvvagehpspfpyahvvsstthktlrgprggiimtndeelakkinsaifpgi
    qggplmhviaakavgfkfnlsdewkvyakqvrtnaqvlanvlmdrkfklvsdgtdnhlvl
    msfldrefsgkdadlalgnagitankntvpgeirspfitsglrlgtpaltargfkekeme
    ivsnyiadilddvnneklqenikqelkklasnfiiyeramf