PDB entry 3n0k

View 3n0k on RCSB PDB site
Description: proteinase inhibitor from coprinopsis cinerea
Deposited on 2010-05-14, released 2011-06-01
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease inhibitor 1
    Species: Coprinopsis cinerea [TaxId:5346]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3n0kA (A:)
    msikpgtyevtskvnglhvgrplaedrsllpkrirvlpednnsgnswvvekdddayilyc
    kgapvapqegklfadllgnmedkkwivthqpqhgenvftvvnastehgwvvpadaeelqq
    vevrpliaapsypprypatelftftqvesd