PDB entry 3n0i

View 3n0i on RCSB PDB site
Description: Crystal Structure of Ad37 fiber knob in complex with GD1a oligosaccharide
Class: cell adhesion
Keywords: adenovirus, fiber knob, ganglioside, GD1a, virus-receptor complex, oligosaccharide structure, protein carbohydrate interaction, cell adhesion
Deposited on 2010-05-14, released 2010-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.16
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fiber
    Species: HUMAN ADENOVIRUS 37 [TaxId:52275]
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n0ia_
  • Chain 'B':
    Compound: Fiber
    Species: HUMAN ADENOVIRUS 37 [TaxId:52275]
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n0ib_
  • Chain 'C':
    Compound: Fiber
    Species: HUMAN ADENOVIRUS 37 [TaxId:52275]
    Gene: L5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n0ic_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n0iA (A:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpkiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0iA (A:)
    dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpki
    ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk
    yardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsy
    iaqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n0iB (B:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpkiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0iB (B:)
    ydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpk
    iksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnsk
    kyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfs
    yiaqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n0iC (C:)
    gamgswnpkydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyh
    iinnktnpkiksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlv
    aypkpsnskkyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenve
    fettsftfsyiaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0iC (C:)
    trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik
    sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
    ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi
    aqe