PDB entry 3n0h

View 3n0h on RCSB PDB site
Description: hDHFR double mutant Q35S/N64F Trimethoprim Binary Complex
Class: oxidoreductase
Keywords: double mutant human dihydrofolate reductase trimethoprim, OXIDOREDUCTASE
Deposited on 2010-05-14, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: DHFR, DHFRP1, pds5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00374 (0-185)
      • engineered mutation (34)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d3n0ha_
  • Heterogens: TOP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n0hA (A:)
    vgslncivavsqnmgigkngdlpwpplrnefryfsrmtttssvegkqnlvimgkktwfsi
    pekfrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
    ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
    vyeknd