PDB entry 3n0b

View 3n0b on RCSB PDB site
Description: TM0449 mutant crystals grown in loops/micromounts
Class: transferase
Keywords: Crystals in loops, thyX, FDTS, TRANSFERASE
Deposited on 2010-05-13, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase thyX
    Species: Thermotoga maritima [TaxId:2336]
    Gene: thy1, thyX, tm0449, TM_0449
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYT0 (12-End)
      • expression tag (11)
      • engineered mutation (169)
      • engineered mutation (171)
    Domains in SCOPe 2.07: d3n0ba1, d3n0ba2
  • Chain 'B':
    Compound: Thymidylate synthase thyX
    Species: Thermotoga maritima [TaxId:2336]
    Gene: thy1, thyX, tm0449, TM_0449
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYT0 (12-231)
      • engineered mutation (169)
      • engineered mutation (171)
    Domains in SCOPe 2.07: d3n0bb_
  • Chain 'C':
    Compound: Thymidylate synthase thyX
    Species: Thermotoga maritima [TaxId:2336]
    Gene: thy1, thyX, tm0449, TM_0449
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYT0 (12-231)
      • engineered mutation (169)
      • engineered mutation (171)
    Domains in SCOPe 2.07: d3n0bc_
  • Chain 'D':
    Compound: Thymidylate synthase thyX
    Species: Thermotoga maritima [TaxId:2336]
    Gene: thy1, thyX, tm0449, TM_0449
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYT0 (12-End)
      • engineered mutation (169)
      • engineered mutation (171)
    Domains in SCOPe 2.07: d3n0bd_
  • Heterogens: UMP, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n0bA (A:)
    mgsdkihhhhhhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieyl
    mkhghetpfehivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperleg
    ykttippervtekiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslm
    nflnlradshaqweiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0bA (A:)
    hmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfeh
    ivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervt
    ekiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradsha
    qweiqqyalaiarifkekcpwtfeaflkyaykgdil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n0bB (B:)
    mgsdkihhhhhhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieyl
    mkhghetpfehivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperleg
    ykttippervtekiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslm
    nflnlradshaqweiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0bB (B:)
    mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
    vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
    kiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaq
    weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n0bC (C:)
    mgsdkihhhhhhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieyl
    mkhghetpfehivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperleg
    ykttippervtekiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslm
    nflnlradshaqweiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0bC (C:)
    mkidildkgfvelvdvmgndlsavraarvsfddeerdrhlieylmkhghetpfehivftf
    hvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervtekise
    ivdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaqweiq
    qyalaiarifkekcpwtfeaflkyaykgdilkevqv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n0bD (D:)
    mgsdkihhhhhhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieyl
    mkhghetpfehivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperleg
    ykttippervtekiseivdkayrtyleliesgvprevarivlplnlytrafatvnarslm
    nflnlradshaqweiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0bD (D:)
    mkidildkgfvelvdvmgndlsavraarvsfdeerdrhlieylmkhghetpfehivftfh
    vkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervtekisei
    vdkayrtyleliesgvprevarivlplnlytrafatvnarslmnflnlradshaqweiqq
    yalaiarifkekcpwtfeaflkyaykgdil