PDB entry 3n08

View 3n08 on RCSB PDB site
Description: Crystal Structure of a Putative PhosphatidylEthanolamine-Binding Protein (PEBP) Homolog CT736 from Chlamydia trachomatis D/UW-3/CX
Class: PhosphatidylEthanolamine-Binding Protein
Keywords: eukarytic homolog Raf Kinase Inhibitor Protein (RKIP). CSGID, Structural Genomics, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Department of Health and Human Services, Center for Structural Genomics of Infectious Diseases, PhosphatidylEthanolamine-Binding Protein
Deposited on 2010-05-13, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.153
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative PhosphatidylEthanolamine-Binding Protein (PEBP)
    Species: Chlamydia trachomatis [TaxId:272561]
    Gene: CT_736, ybcL
    Database cross-references and differences (RAF-indexed):
    • Uniprot O84741 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3n08a1, d3n08a2
  • Chain 'B':
    Compound: Putative PhosphatidylEthanolamine-Binding Protein (PEBP)
    Species: Chlamydia trachomatis [TaxId:272561]
    Gene: CT_736, ybcL
    Database cross-references and differences (RAF-indexed):
    • Uniprot O84741 (3-152)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3n08b1, d3n08b2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n08A (A:)
    snamqltsqafsygrpipkkyscqgvgispplsfsdvpreakslvlivedpdvppsvred
    glwihwivynlspvvsnlaegaqifavqglntageigycppcppdakhryyfyayaldvv
    lsdeegvtkeqlleamdghiiataelmgtyekd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n08A (A:)
    namqltsqafsygrpipkkyscqgvgispplsfsdvpreakslvlivedpdvppsvredg
    lwihwivynlspvvsnlaegaqifavqglntageigycppcppdakhryyfyayaldvvl
    sdeegvtkeqlleamdghiiataelmgtyek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n08B (B:)
    snamqltsqafsygrpipkkyscqgvgispplsfsdvpreakslvlivedpdvppsvred
    glwihwivynlspvvsnlaegaqifavqglntageigycppcppdakhryyfyayaldvv
    lsdeegvtkeqlleamdghiiataelmgtyekd