PDB entry 3n05

View 3n05 on RCSB PDB site
Description: crystal structure of nh3-dependent nad+ synthetase from streptomyces avermitilis
Deposited on 2010-05-13, released 2010-07-07
The last revision was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.233
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Streptomyces avermitilis [TaxId:33903]
    Gene: nadE, SAV5948, SAV_5948
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82AV7 (3-582)
      • expression tag (1-2)
      • expression tag (583-584)
  • Chain 'B':
    Compound: nh(3)-dependent nad(+) synthetase
    Species: Streptomyces avermitilis [TaxId:33903]
    Gene: nadE, SAV5948, SAV_5948
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82AV7 (3-582)
      • expression tag (1-2)
      • expression tag (583-584)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n05A (A:)
    mslqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrs
    sfveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgr
    valtfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsag
    aglllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdg
    evvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggya
    drldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalgaqnvygvsm
    pskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlqsrlrgttlm
    aisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrlaewrnraaaerg
    qtppipeasitkppsaelrpgqvdtdslpdypvldailelyvdrdtgadaivaagydrel
    vvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwreghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n05A (A:)
    slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss
    fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv
    altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga
    glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge
    vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad
    rldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalgaqnvygvsmp
    skyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlqsrlrgttlma
    isnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrlaewrnraaaergq
    tppipeasitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrq
    yppgtkisakgfgkdrrlpitnrwregh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n05B (B:)
    mslqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrs
    sfveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgr
    valtfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsag
    aglllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdg
    evvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggya
    drldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalgaqnvygvsm
    pskyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlqsrlrgttlm
    aisnqeghivlapgnkselavgystlygdsvgaygpikdvyktsifrlaewrnraaaerg
    qtppipeasitkppsaelrpgqvdtdslpdypvldailelyvdrdtgadaivaagydrel
    vvktlrmvdtaeykrrqyppgtkisakgfgkdrrlpitnrwreghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3n05B (B:)
    slqlrlalnqidstvgdiagnaeailrwtrhsaeqgahlvafpemaltgypvedlalrss
    fveasrtalrelaarlaeegfgelpvlvgyldrsesaqpkygqpagaprnaaavlhrgrv
    altfakhhlpnygvfdefryfvpgdtmpivrlhgvdialaicedlwqdggrvpaarsaga
    glllsvnaspyerdkddtrlelvrkraqeagcttaylamiggqdelvfdgdsivvdrdge
    vvarapqfsegcvvldldlpaaeaepptgvvddglridrlviseeplpayeaelaggyad
    rldadeevysalvvglrayvakngfrsvliglsggidsalvaaiacdalgaqnvygvsmp
    skyssdhskgdaaelarrtglnfrtvsiepmfdaymaslgltglaeenlqsrlrgttlma
    isnqeghivlapgnkselavgyssvgaygpikdvyktsifrlaewrnraaaergqtppip
    easitkpdypvldailelyvdrdtgadaivaagydrelvvktlrmvdtaeykrrqyppgt
    kisakgfgkdrrlpitnrwregh