PDB entry 3n04

View 3n04 on RCSB PDB site
Description: the crystal structure of the alpha-glucosidase (family 31) from ruminococcus obeum atcc 29174
Deposited on 2010-05-13, released 2010-06-23
The last revision was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-glucosidase
    Species: Ruminococcus obeum [TaxId:411459]
    Gene: RUMOBE_03919
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5ZY13 (3-665)
      • expression tag (2)
  • Chain 'B':
    Compound: alpha-glucosidase
    Species: Ruminococcus obeum [TaxId:411459]
    Gene: RUMOBE_03919
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5ZY13 (3-665)
      • expression tag (2)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n04A (A:)
    snamirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesn
    rginkrgycyisnctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytr
    mdtlkvscenadldiyviegenaydivkqfrrvigrsyippkfafgfgqsrwgyttkedf
    ravakgyrenhipidmiymdidymqdfkdftvneknfpdfpefvkemkdqelrlipiida
    gvkvekgyevyeegvknnyfckredgsdfvaavwpgdthfpdmlnpearkwfgdkyrfli
    dqgiegfwndmnepaifysseglaeakefagefakdtegkihpwamqakmkdivnspedy
    krfyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryggiw
    mgdnkswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrd
    haaegtreqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddk
    mairvedqlmlgneimiapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvd
    valnevplfirsgkcipvaeaaecvkdidtenmqligyegssytlyeddgihkdydkken
    yrvltk
    

    Sequence, based on observed residues (ATOM records):
    >3n04A (A:)
    amirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesnrg
    inkrgycyisnctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytrmd
    tlkvscenadldiyviegenaydivkqfrrvigrsyippkfafgfgqsrwgyttkedfra
    vakgyrenhipidmiymdidymqdfkdftvneknfpdfpefvkemkdqelrlipiidagv
    kvekgyevyeegvknnyfckredgsdfvaavwpgdthfpdmlnpearkwfgdkyrflidq
    giegfwndmnepaifysseglaeakefagefakdtegkihpwamqakmkdivnspedykr
    fyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryggiwmg
    dnkswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrdha
    aegtreqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddkma
    irvedqlmlgneimiapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvdva
    lnevplfirsgkcipvaeaaecvkdidtenmqligyegssytlyeddgihkdydkkenyr
    vltk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3n04B (B:)
    snamirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesn
    rginkrgycyisnctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytr
    mdtlkvscenadldiyviegenaydivkqfrrvigrsyippkfafgfgqsrwgyttkedf
    ravakgyrenhipidmiymdidymqdfkdftvneknfpdfpefvkemkdqelrlipiida
    gvkvekgyevyeegvknnyfckredgsdfvaavwpgdthfpdmlnpearkwfgdkyrfli
    dqgiegfwndmnepaifysseglaeakefagefakdtegkihpwamqakmkdivnspedy
    krfyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryggiw
    mgdnkswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrd
    haaegtreqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddk
    mairvedqlmlgneimiapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvd
    valnevplfirsgkcipvaeaaecvkdidtenmqligyegssytlyeddgihkdydkken
    yrvltk
    

    Sequence, based on observed residues (ATOM records):
    >3n04B (B:)
    amirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesnrg
    inkrgycyisnctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytrmd
    tlkvscenadldiyviegenaydivkqfrrvigrsyippkfafgfgqsrwgyttkedfra
    vakgyrenhipidmiymdidymqdfkdftvneknfpdfpefvkemkdqelrlipiidagv
    kvekgyevyeegvknnyfckredgsdfvaavwpgdthfpdmlnpearkwfgdkyrflidq
    giegfwndmnepaifysseglaeakefagefakdtegkihpwamqakmkdivnspedykr
    fyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryggiwmg
    dnkswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrdha
    aegtreqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddkma
    irvedqlmlgneimiapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvdva
    lnevplfirsgkcipvaeaaecvkdidtenmqligyegssytlyeddgihkdydkkenyr
    vltk