PDB entry 3n03

View 3n03 on RCSB PDB site
Description: Thaumatin crystals grown from drops
Class: plant protein
Keywords: Crystals on loops, Thaumatin, PLANT PROTEIN
Deposited on 2010-05-13, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thaumatin-1
    Species: Thaumatococcus daniellii [TaxId:4621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n03a_
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n03A (A:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpt