PDB entry 3n00

View 3n00 on RCSB PDB site
Description: crystal structure of a deletion mutant of human reverba ligand binding domain bound with an ncor id1 peptide determined to 2.60a
Deposited on 2010-05-13, released 2010-06-30
The last revision was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rev-erbA-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1D1, EAR1, HREV, THRAL
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nuclear receptor corepressor 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3n00A (A:)
    mkkhhhhhhgpeptvedvisqvarahreiftyahdklgsspgnfnanhasgspyphgrsg
    rtvqeiwedfsmsftpavrevvefakhipgfrdlsqhdqvtllkagtfevlmvrfaslfn
    vkdqtvmflsrttyslqelgamgmgdllsamfdfseklnslalteeelglftavvlvsad
    rsgmensasveqlqetllralralvlknrpletsrftklllklpdlrtlnnmhsekllsf
    rvdaq
    

    Sequence, based on observed residues (ATOM records):
    >3n00A (A:)
    ptvedvisqvarahreifvqeiwedfsmsftpavrevvefakhipgfrdlsqhdqvtllk
    agtfevlmvrfaslfnvkdelgamgmgdllsamfdfseklnslalteeelglftavvlvs
    adrsgmensasveqlqetllralralvlknrpletsrftklllklpdlrtlnnmhsekll
    sfrv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3n00B (B:)
    thrlitladhicqiitqdfar