PDB entry 3mzz

View 3mzz on RCSB PDB site
Description: Crystal Structure of Rhodanese-like Domain Protein from Staphylococcus aureus
Deposited on 2010-05-13, released 2010-06-30
The last revision was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhodanese-like domain protein
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: SACOL1807
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mzzA (A:)
    mksittdelknklleskpvqivdvrtdeetamgyipnaklipmdtipdnlnsfnkneiyy
    ivcaggvrsakvveyleangidavnveggmhawgdegleiksi