PDB entry 3mzy

View 3mzy on RCSB PDB site
Description: the crystal structure of the rna polymerase sigma-h factor from fusobacterium nucleatum to 2.5a
Deposited on 2010-05-13, released 2010-06-02
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma-H factor
    Species: Fusobacterium nucleatum subsp. nucleatum [TaxId:190304]
    Gene: FN1518
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mzyA (A:)
    gaekedlvqegilgllkaikfydetkssfssfaflcirremisairkantqkhmvlneal
    ktnailedsayfddeghninnykssesnpeeayllkeeieefkkfsennfskfekevlty
    lirgysyreiatilsknlksidntiqrirkkseewikeeenikr
    

    Sequence, based on observed residues (ATOM records):
    >3mzyA (A:)
    edlvqegilgllkaikfydetkssfssfaflcirremisairkantqkeeayllkeeiee
    fkkfsennfskfekevltylirgysyreiatilsknlksidntiqrirkkseewikeeen
    ikr