PDB entry 3mzr

View 3mzr on RCSB PDB site
Description: RNase crystals grown in loops/micromounts
Class: hydrolase
Keywords: crystals on loops, RNase from drops, HYDROLASE
Deposited on 2010-05-12, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.177
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mzra_
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mzrA (A:)
    pslgketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqa
    vcsqknvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyv
    pvhfdasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mzrA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv