PDB entry 3mzq

View 3mzq on RCSB PDB site
Description: RNase crystals grown by the hanging drop method
Class: hydrolase
Keywords: Crystals on loops, Rnase, HYDROLASE
Deposited on 2010-05-12, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mzqa_
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mzqA (A:)
    pslgketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqa
    vcsqknvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyv
    pvhfdasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mzqA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv