PDB entry 3mzo

View 3mzo on RCSB PDB site
Description: crystal structure of a hd-domain phosphohydrolase (lin2634) from listeria innocua at 1.98 a resolution
Deposited on 2010-05-12, released 2010-05-26
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin2634 protein
    Species: Listeria innocua [TaxId:1642]
    Gene: lin2634
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q928A2 (1-End)
      • leader sequence (0)
  • Chain 'B':
    Compound: Lin2634 protein
    Species: Listeria innocua [TaxId:1642]
    Gene: lin2634
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Lin2634 protein
    Species: Listeria innocua [TaxId:1642]
    Gene: lin2634
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q928A2 (1-End)
      • leader sequence (0)
  • Heterogens: CA, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mzoA (A:)
    gmgihqyfqslsdleniyrcpgkfkyqehsvaehsykvtsiaqffgaveedagnevnwra
    lyekalnhdyselfigdiktpvkyattelremlseveesmtknfisreipatfqpiyrhl
    lkegkdstlegkilaisdkvdllyesfgeiqkgnpenifveiysealatiyeyremasvk
    yflkeilpdmlaekgiektelpqltteittkalrde
    

    Sequence, based on observed residues (ATOM records):
    >3mzoA (A:)
    gmgihqyfqslsdleniyrcpgkfkyqehsvaehsykvtsiaqffgaveedagnevnwra
    lyekalnhdyselfigdiktpvkyattelremlseveesmtknfisreipatfqpiyrhl
    lkegkdstlegkilaisdkvdllyesfgeiqkgnpenifveiysealatiyeyremasvk
    yflkeilpdmlaekgiektelpqltteitt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mzoB (B:)
    gmgihqyfqslsdleniyrcpgkfkyqehsvaehsykvtsiaqffgaveedagnevnwra
    lyekalnhdyselfigdiktpvkyattelremlseveesmtknfisreipatfqpiyrhl
    lkegkdstlegkilaisdkvdllyesfgeiqkgnpenifveiysealatiyeyremasvk
    yflkeilpdmlaekgiektelpqltteittkalrde
    

    Sequence, based on observed residues (ATOM records):
    >3mzoB (B:)
    mgihqyfqslsdleniyrcpgkfkyqehsvaehsykvtsiaqffgaveedagnevnwral
    yekalnhdyselfigdiktpvkyattelremlseveesmtknfisreipatfqpiyrhll
    kegkdstlegkilaisdkvdllyesfgeiqkgnpenifveiysealatiyeyremasvky
    flkeilpdmlaekgiektelpqltteittka
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mzoC (C:)
    gmgihqyfqslsdleniyrcpgkfkyqehsvaehsykvtsiaqffgaveedagnevnwra
    lyekalnhdyselfigdiktpvkyattelremlseveesmtknfisreipatfqpiyrhl
    lkegkdstlegkilaisdkvdllyesfgeiqkgnpenifveiysealatiyeyremasvk
    yflkeilpdmlaekgiektelpqltteittkalrde
    

    Sequence, based on observed residues (ATOM records):
    >3mzoC (C:)
    gmgihqyfqslsdleniyrcpgkfkyqehsvaehsykvtsiaqffgaveedagnevnwra
    lyekalnhdyselfiemlseveesmtknfisreipatfqpiyrhllkegkdstlegkila
    isdkvdllyesfgeiqkgnpenifveiysealatiyeyremasvkyflkeilpdmlaekg
    iektelpqltteittk