PDB entry 3mzn

View 3mzn on RCSB PDB site
Description: Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043
Class: lyase
Keywords: LYASE, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, NYSGRC, NEW YORK STRUCTURAL GENOMICS RESEARCH CONSORTIUM, NYSGXRC, New York SGX Research Center for Structural Genomics
Deposited on 2010-05-12, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.155
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2481
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QUN0 (3-441)
      • expression tag (2)
      • expression tag (442-447)
    Domains in SCOPe 2.07: d3mzna1, d3mzna2, d3mzna3, d3mzna4
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2481
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QUN0 (3-441)
      • expression tag (1-2)
      • expression tag (442-446)
    Domains in SCOPe 2.07: d3mznb1, d3mznb2, d3mznb3, d3mznb4
  • Heterogens: SO4, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mznA (A:)
    mslfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegiln
    glekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdl
    fgqalgmpvadllgqygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryrea
    mtpeavanlaraaydrygfkdfklkggvlrgeeeadciralheafpearlaldpngawkl
    deavrvlepikhllsyaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyav
    qlnsvdipladchfwtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgei
    taidthwiwqdgqritrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrn
    damamqylipgwefdpkrpalveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mznA (A:)
    lfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegilngl
    ekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdlfg
    qalgmpvadllgqygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryreamt
    peavanlaraaydrygfkdfklkggvlrgeeeadciralheafpearlaldpngawklde
    avrvlepikhllsyaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyavql
    nsvdipladchfwtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgeita
    idthwiwqdgqritrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrnda
    mamqylipgwefdpkrpalveghhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mznB (B:)
    mslfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegiln
    glekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdl
    fgqalgmpvadllgqygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryrea
    mtpeavanlaraaydrygfkdfklkggvlrgeeeadciralheafpearlaldpngawkl
    deavrvlepikhllsyaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyav
    qlnsvdipladchfwtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgei
    taidthwiwqdgqritrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrn
    damamqylipgwefdpkrpalveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mznB (B:)
    slfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegilng
    lekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdlf
    gqalgmpvadllgqygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryream
    tpeavanlaraaydrygfkdfklkggvlrgeeeadciralheafpearlaldpngawkld
    eavrvlepikhllsyaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyavq
    lnsvdipladchfwtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgeit
    aidthwiwqdgqritrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrnd
    amamqylipgwefdpkrpalveghhh