PDB entry 3mzl

View 3mzl on RCSB PDB site
Description: sec13/sec31 edge element, loop deletion mutant
Deposited on 2010-05-12, released 2010-08-18
The last revision was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein transport protein SEC13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ANU3, L8167.4, SEC13, YLR208W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein transport protein SEC31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: D1229, SEC31, WEB1, YDL195W
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Protein transport protein SEC13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ANU3, L8167.4, SEC13, YLR208W
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Protein transport protein SEC31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: D1229, SEC31, WEB1, YDL195W
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Protein transport protein SEC13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ANU3, L8167.4, SEC13, YLR208W
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Protein transport protein SEC31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: D1229, SEC31, WEB1, YDL195W
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Protein transport protein SEC13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ANU3, L8167.4, SEC13, YLR208W
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Protein transport protein SEC31
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: D1229, SEC31, WEB1, YDL195W
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mzlA (A:)
    mvvianahnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvd
    wahpkfgtilascsydgkvliwkeengrwsqiavhavhsasvnsvqwapheygplllvas
    sdgkvsvvefkengttspiiidahaigvnsaswapatieedgehngtkesrkfvtggadn
    lvkiwkynsdaqtyvlestleghsdwvrdvawsptvllrsylasvsqdrtciiwtqdneq
    gpwkktllkeekfpdvlwraswslsgnvlalsggdnkvtlwkenlegkwepagevhq
    

    Sequence, based on observed residues (ATOM records):
    >3mzlA (A:)
    vvianahnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvdw
    ahpkfgtilascsydgkvliwkeengrwsqiavhavhsasvnsvqwapheygplllvass
    dgkvsvvefkengttspiiidahaigvnsaswapatsrkfvtggadnlvkiwkynsdaqt
    yvlestleghsdwvrdvawsptvllrsylasvsqdrtciiwtqdneqgpwkktllkeekf
    pdvlwraswslsgnvlalsggdnkvtlwkenlegkwepa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mzlB (B:)
    gphlqaptwygepspaahwafggklvqitpdgkgvsitnpkisglesnttlsealktkdf
    kplinqrlvkviddvneedwnlleklsmdgteeflkealafdndesgnieqtisknlvsg
    niksavknslendllmeamvialdsnnerlkesvknayfakygsksslsrilysiskrev
    ddlvenldvsqwkfiskaiqnlypndiaqrnemliklgdrlkenghrqdsltlylaagsl
    dkvasiwlsefpdledklkkdnktiyeahsecltefierftvfsnfingsstinneqlia
    kflefinlttstgnfelateflnslpsdneevktekarvliasgk
    

    Sequence, based on observed residues (ATOM records):
    >3mzlB (B:)
    wygepspaahwafggklvqitpdgkgvsitnpkisglesnttlsealktkdfkplinqrl
    vkviddvneedwnlleklsmdgteeflkealafdgnieqtisknlvsgniksavknslen
    dllmeamvialdsnnerlkesvknayfakygsksslsrilysiskrevddlvenldvsqw
    kfiskaiqnlypndiaqrnemliklgdrlkenghrqdsltlylaagsldkvasiwlsefp
    dledklkkdnktiyeahsecltefierftvfsnfinginneqliakflefinlttstgnf
    elateflnslpsdneevktekarvliasg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mzlC (C:)
    mvvianahnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvd
    wahpkfgtilascsydgkvliwkeengrwsqiavhavhsasvnsvqwapheygplllvas
    sdgkvsvvefkengttspiiidahaigvnsaswapatieedgehngtkesrkfvtggadn
    lvkiwkynsdaqtyvlestleghsdwvrdvawsptvllrsylasvsqdrtciiwtqdneq
    gpwkktllkeekfpdvlwraswslsgnvlalsggdnkvtlwkenlegkwepagevhq
    

    Sequence, based on observed residues (ATOM records):
    >3mzlC (C:)
    vvianahnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvdw
    ahpkfgtilascsydgkvliwkeengrwsqiavhavhsasvnsvqwapheygplllvass
    dgkvsvvefkengttspiiidahaigvnsaswapatsrkfvtggadnlvkiwkynsdaqt
    yvlestleghsdwvrdvawsptvllrsylasvsqdrtciiwtqdneqgpwkktllkeekf
    pdvlwraswslsgnvlalsggdnkvtlwkenlegkwepa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mzlD (D:)
    gphlqaptwygepspaahwafggklvqitpdgkgvsitnpkisglesnttlsealktkdf
    kplinqrlvkviddvneedwnlleklsmdgteeflkealafdndesgnieqtisknlvsg
    niksavknslendllmeamvialdsnnerlkesvknayfakygsksslsrilysiskrev
    ddlvenldvsqwkfiskaiqnlypndiaqrnemliklgdrlkenghrqdsltlylaagsl
    dkvasiwlsefpdledklkkdnktiyeahsecltefierftvfsnfingsstinneqlia
    kflefinlttstgnfelateflnslpsdneevktekarvliasgk
    

    Sequence, based on observed residues (ATOM records):
    >3mzlD (D:)
    wygepspaahwafggklvqitpdgkgvsitnpkisglesnttlsealktkdfkplinqrl
    vkviddvneedwnlleklsmdgteeflkealafdgnieqtisknlvsgniksavknslen
    dllmeamvialdsnnerlkesvknayfakygsksslsrilysiskrevddlvenldvsqw
    kfiskaiqnlypndiaqrnemliklgdrlkenghrqdsltlylaagsldkvasiwlsefp
    dledklkkdnktiyeahsecltefierftvfsnfinginneqliakflefinlttstgnf
    elateflnslpsdneevktekarvliasg
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mzlE (E:)
    mvvianahnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvd
    wahpkfgtilascsydgkvliwkeengrwsqiavhavhsasvnsvqwapheygplllvas
    sdgkvsvvefkengttspiiidahaigvnsaswapatieedgehngtkesrkfvtggadn
    lvkiwkynsdaqtyvlestleghsdwvrdvawsptvllrsylasvsqdrtciiwtqdneq
    gpwkktllkeekfpdvlwraswslsgnvlalsggdnkvtlwkenlegkwepagevhq
    

    Sequence, based on observed residues (ATOM records):
    >3mzlE (E:)
    vvianahnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvdw
    ahpkfgtilascsydgkvliwkeengrwsqiavhavhsasvnsvqwapheygplllvass
    dgkvsvvefkengttspiiidahaigvnsaswapatsrkfvtggadnlvkiwkynsdaqt
    yvlestleghsdwvrdvawsptvllrsylasvsqdrtciiwtqdneqgpwkktllkeekf
    pdvlwraswslsgnvlalsggdnkvtlwkenlegkwepa
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mzlF (F:)
    gphlqaptwygepspaahwafggklvqitpdgkgvsitnpkisglesnttlsealktkdf
    kplinqrlvkviddvneedwnlleklsmdgteeflkealafdndesgnieqtisknlvsg
    niksavknslendllmeamvialdsnnerlkesvknayfakygsksslsrilysiskrev
    ddlvenldvsqwkfiskaiqnlypndiaqrnemliklgdrlkenghrqdsltlylaagsl
    dkvasiwlsefpdledklkkdnktiyeahsecltefierftvfsnfingsstinneqlia
    kflefinlttstgnfelateflnslpsdneevktekarvliasgk
    

    Sequence, based on observed residues (ATOM records):
    >3mzlF (F:)
    wygepspaahwafggklvqitpdgkgvsitnpkisglesnttlsealktkdfkplinqrl
    vkviddvneedwnlleklsmdgteeflkealafdgnieqtisknlvsgniksavknslen
    dllmeamvialdsnnerlkesvknayfakygsksslsrilysiskrevddlvenldvsqw
    kfiskaiqnlypndiaqrnemliklgdrlkenghrqdsltlylaagsldkvasiwlsefp
    dledklkkdnktiyeahsecltefierftvfsnfinginneqliakflefinlttstgnf
    elateflnslpsdneevktekarvliasg
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mzlG (G:)
    mvvianahnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvd
    wahpkfgtilascsydgkvliwkeengrwsqiavhavhsasvnsvqwapheygplllvas
    sdgkvsvvefkengttspiiidahaigvnsaswapatieedgehngtkesrkfvtggadn
    lvkiwkynsdaqtyvlestleghsdwvrdvawsptvllrsylasvsqdrtciiwtqdneq
    gpwkktllkeekfpdvlwraswslsgnvlalsggdnkvtlwkenlegkwepagevhq
    

    Sequence, based on observed residues (ATOM records):
    >3mzlG (G:)
    vvianahnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvdw
    ahpkfgtilascsydgkvliwkeengrwsqiavhavhsasvnsvqwapheygplllvass
    dgkvsvvefkengttspiiidahaigvnsaswapatsrkfvtggadnlvkiwkynsdaqt
    yvlestleghsdwvrdvawsptvllrsylasvsqdrtciiwtqdneqgpwkktllkeekf
    pdvlwraswslsgnvlalsggdnkvtlwkenlegkwepa
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mzlH (H:)
    gphlqaptwygepspaahwafggklvqitpdgkgvsitnpkisglesnttlsealktkdf
    kplinqrlvkviddvneedwnlleklsmdgteeflkealafdndesgnieqtisknlvsg
    niksavknslendllmeamvialdsnnerlkesvknayfakygsksslsrilysiskrev
    ddlvenldvsqwkfiskaiqnlypndiaqrnemliklgdrlkenghrqdsltlylaagsl
    dkvasiwlsefpdledklkkdnktiyeahsecltefierftvfsnfingsstinneqlia
    kflefinlttstgnfelateflnslpsdneevktekarvliasgk
    

    Sequence, based on observed residues (ATOM records):
    >3mzlH (H:)
    wygepspaahwafggklvqitpdgkgvsitnpkisglesnttlsealktkdfkplinqrl
    vkviddvneedwnlleklsmdgteeflkealafdgnieqtisknlvsgniksavknslen
    dllmeamvialdsnnerlkesvknayfakygsksslsrilysiskrevddlvenldvsqw
    kfiskaiqnlypndiaqrnemliklgdrlkenghrqdsltlylaagsldkvasiwlsefp
    dledklkkdnktiyeahsecltefierftvfsnfinginneqliakflefinlttstgnf
    elateflnslpsdneevktekarvliasg