PDB entry 3mzk

View 3mzk on RCSB PDB site
Description: Sec13/Sec16 complex, S.cerevisiae
Deposited on 2010-05-12, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.2
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein transport protein SEC13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ANU3, L8167.4, SEC13, YLR208W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein transport protein SEC16
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LPF1W, SEC16, YPL085W
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Protein transport protein SEC16
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LPF1W, SEC16, YPL085W
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Protein transport protein SEC13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ANU3, L8167.4, SEC13, YLR208W
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mzkA (A:)
    mvvianahnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvd
    wahpkfgtilascsydgkvliwkeengrwsqiavhavhsasvnsvqwapheygplllvas
    sdgkvsvvefkengttspiiidahaigvnsaswapatieedgehngtkesrkfvtggadn
    lvkiwkynsdaqtyvlestleghsdwvrdvawsptvllrsylasvsqdrtciiwtqdneq
    gpwkktllkeekfpdvlwraswslsgnvlalsggdnkvtlwkenlegkwepagevhq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mzkB (B:)
    gpgsdneallrrqfpifhwsaankvvyavppipdqsqymisssivqeikvtpidqiikpn
    dmlksfpgplgsaklkkkdltkwmettiksisenesstdmtiwqllemklndkvnwknis
    kllynsdellmylsqpfpngdmipnayrldincqmrvlaflqtgnhdealrlalskrdya
    iallvgslmgkdrwseviqkylyegftagpndqkelahflllifqvfvgnskmaiksfyt
    nnetsqwasenwksivaavlinipennedpllippvvlefliefgifltkkgltaaastl
    fiignvplsnepvmadsdvifesignmntfesilwdeiyeyifsydpkfkgfssilpqki
    yhasllqeqglnslgtkytdylsssvrklpkkdiltinltrelsevasrlsesntgwlak
    pklssvwgqldksfnkyiggd
    

    Sequence, based on observed residues (ATOM records):
    >3mzkB (B:)
    llrrqfpifhwsaankvvyavppivqeikvtpidqiikpndmlksfpgplgsaklkkkdl
    tkwmettiksisenesstdmtiwqllemklndkvnwkniskllynsdellmylsqpfpng
    dmipnayrldincqmrvlaflqtgnhdealrlalskrdyaiallvgslmgkdrwseviqk
    ylyegdqkelahflllifqvfvgnskmaiksfytnnetsqwasenwksivaavlinipen
    nedpllippvvlefliefgifltkkgltaaastlfiignvplsnepvmadsdvifesign
    mntfesilwdeiyeyifsydpkfkgfssilpqkiyhasllqeqglnslgtkytdylsssv
    rklpkkdiltinltrelsevasrls
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mzkC (C:)
    gpgsdneallrrqfpifhwsaankvvyavppipdqsqymisssivqeikvtpidqiikpn
    dmlksfpgplgsaklkkkdltkwmettiksisenesstdmtiwqllemklndkvnwknis
    kllynsdellmylsqpfpngdmipnayrldincqmrvlaflqtgnhdealrlalskrdya
    iallvgslmgkdrwseviqkylyegftagpndqkelahflllifqvfvgnskmaiksfyt
    nnetsqwasenwksivaavlinipennedpllippvvlefliefgifltkkgltaaastl
    fiignvplsnepvmadsdvifesignmntfesilwdeiyeyifsydpkfkgfssilpqki
    yhasllqeqglnslgtkytdylsssvrklpkkdiltinltrelsevasrlsesntgwlak
    pklssvwgqldksfnkyiggd
    

    Sequence, based on observed residues (ATOM records):
    >3mzkC (C:)
    rrqfpifhwsaankvvyavppivqeikvtpidqiikpndmlksfpgplgsaklkkkdltk
    wmettiksisenesstdmtiwqllemklndkvnwkniskllynsdellmylsqpfpngdm
    ipnayrldincqmrvlaflqtgnhdealrlalskrdyaiallvgslmgkdrwseviqkyl
    yegkelahflllifqvfvgnskmaiksfytnnetsqwasenwksivaavlinipennedp
    llippvvlefliefgifltkkgltaaastlfiignvplsnepvmadsdvifesignmntf
    esilwdeiyeyifsydpkfkgfssilpqkiyhasllqeqglnslgtkytdylsssvrklp
    kkdiltinltrelsevasrls
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3mzkD (D:)
    mvvianahnelihdavldyygkrlatcssdktikifevegethklidtltghegpvwrvd
    wahpkfgtilascsydgkvliwkeengrwsqiavhavhsasvnsvqwapheygplllvas
    sdgkvsvvefkengttspiiidahaigvnsaswapatieedgehngtkesrkfvtggadn
    lvkiwkynsdaqtyvlestleghsdwvrdvawsptvllrsylasvsqdrtciiwtqdneq
    gpwkktllkeekfpdvlwraswslsgnvlalsggdnkvtlwkenlegkwepagevhq