PDB entry 3mzi

View 3mzi on RCSB PDB site
Description: Crystallographic structure of the pseudo-Signaling State of the BLUF Photoreceptor PixD (slr1694) Y8F mutant
Class: protein binding
Keywords: BLUF (blue-light using FAD) domain, signaling state, phototaxis, protein binding
Deposited on 2010-05-12, released 2011-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.167
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: slr1694
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74295
      • engineered mutation (7)
    Domains in SCOPe 2.07: d3mzia_
  • Chain 'B':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: slr1694
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74295
      • engineered mutation (7)
    Domains in SCOPe 2.07: d3mzib_
  • Chain 'C':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: slr1694
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74295
      • engineered mutation (7)
    Domains in SCOPe 2.07: d3mzic_
  • Chain 'D':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: slr1694
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74295
      • engineered mutation (7)
    Domains in SCOPe 2.07: d3mzid_
  • Chain 'E':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: slr1694
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74295
      • engineered mutation (7)
    Domains in SCOPe 2.07: d3mzie_
  • Chain 'F':
    Compound: Activator of photopigment and puc expression
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: slr1694
    Database cross-references and differences (RAF-indexed):
    • Uniprot P74295
      • engineered mutation (7)
    Domains in SCOPe 2.07: d3mzif_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mziA (A:)
    mslyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mziA (A:)
    slyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvne
    tyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlrp
    samdpeqclnflldiakiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mziB (B:)
    mslyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mziB (B:)
    slyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvne
    tyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlrp
    samdpeqclnflldiakiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mziC (C:)
    mslyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mziC (C:)
    slyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvne
    tyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlrp
    samdpeqclnflldiakiye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mziD (D:)
    mslyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mziD (D:)
    slyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvne
    tyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlrp
    samdpeqclnflldiakiye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mziE (E:)
    mslyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mziE (E:)
    slyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvne
    tyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlrp
    samdpeqclnflldiakiye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mziF (F:)
    mslyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvn
    etyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlr
    psamdpeqclnflldiakiyelsdnffldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mziF (F:)
    slyrlifssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvne
    tyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlrp
    samdpeqclnflldiakiye