PDB entry 3mzg

View 3mzg on RCSB PDB site
Description: Crystal structure of a human prolactin receptor antagonist in complex with the extracellular domain of the human prolactin receptor
Class: hormone/hormone receptor
Keywords: ECD, antagonist, pH dependence, hematopoietic cytokine, HORMONE-HORMONE RECEPTOR complex
Deposited on 2010-05-12, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolactin
    Species: Homo sapiens [TaxId:9606]
    Gene: PRL, Prolactin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01236 (1-185)
      • initiating methionine (0)
      • engineered mutation (115)
    Domains in SCOPe 2.07: d3mzga_
  • Chain 'B':
    Compound: Prolactin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PRLR, Prolactin receptor
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16471 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3mzgb1, d3mzgb2
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mzgA (A:)
    mlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpedkeqaq
    qmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermeli
    vsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcri
    ihnnnc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mzgB (B:)
    mlppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpn
    schfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyivqpdpplelavevkqpedrk
    pylwikwspptlidlktgwftllyeirlkpekaaeweihfagqqtefkilslhpgqkylv
    qvrckpdhgywsawspatfiqipsdftmnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mzgB (B:)
    mlppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpn
    schfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyivqpdpplelavevkqpedrk
    pylwikwspptlidlktgwftllyeirlkpekaaeweihfagqqtefkilslhpgqkylv
    qvrckpdhgywsawspatfiqipsdf