PDB entry 3mzf

View 3mzf on RCSB PDB site
Description: Structure of penicillin-binding protein 5 from E. coli: imipenem acyl-enzyme complex
Class: hydrolase/antibiotic
Keywords: BETA-LACTAM ANTIBIOTIC, PENICILLIN-BINDING PROTEIN, DD-CARBOXYPEPTIDASE, HYDROLASE, HYDROLASE-ANTIBIOTIC complex
Deposited on 2010-05-12, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-alanyl-D-alanine carboxypeptidase dacA
    Species: Escherichia coli [TaxId:83333]
    Gene: b0632, dacA, JW0627, pfv
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mzfa1, d3mzfa2
  • Heterogens: IM2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mzfA (A:)
    ddlniktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamka
    gkfketdlvtigndawatgnpvfkgsslmflkpgmqvpvsqlirginlqsgndacvamad
    faagsqdafvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpney
    siykekeftfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavm
    ggrtfkgreaeskklltwgfrffetvnplkvgkefasepvwfgdsdraslgvdkdvylti
    prgrmkdlkasyvlnsselhaplqknqvvgtinfqldgktieqrplvvlqeipegnfgdp
    vid
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mzfA (A:)
    lniktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamkagk
    fketdlvtigndawatgnpvfkgsslmflkpgmqvpvsqlirginlqsgndacvamadfa
    agsqdafvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpneysi
    ykekeftfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavmgg
    rtfkgreaeskklltwgfrffetvnplkvgkefasepvwfgdsdraslgvdkdvyltipr
    grmkdlkasyvlnsselhaplqknqvvgtinfqldgktieqrplvvlqeipegnf