PDB entry 3mzb

View 3mzb on RCSB PDB site
Description: X-ray structure of NikA in complex with the doubly hydroxylated iron complex, 1-O2
Class: transport protein
Keywords: Protein-bound iron complex, TRANSPORT PROTEIN
Deposited on 2010-05-12, released 2011-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nickel-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: NIKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mzba_
  • Chain 'B':
    Compound: Nickel-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: NIKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mzbb_
  • Heterogens: ACT, SO4, GOL, CL, BHR, FE, DTD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mzbA (A:)
    aapdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedg
    ktwtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqi
    tlksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvr
    nenywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayht
    qlsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpy
    anlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeii
    qadmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfq
    aqqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpel
    gnipyapiateipfeqikpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mzbA (A:)
    apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
    twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
    lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
    enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
    lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
    nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
    admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
    qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
    nipyapiateipfeqikp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mzbB (B:)
    aapdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedg
    ktwtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqi
    tlksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvr
    nenywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayht
    qlsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpy
    anlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeii
    qadmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfq
    aqqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpel
    gnipyapiateipfeqikpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mzbB (B:)
    deittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgktw
    tftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitlk
    sayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrnen
    ywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtqls
    qpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyanl
    glkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqad
    mrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaqq
    gladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgni
    pyapiateipfeqikp