PDB entry 3mz8

View 3mz8 on RCSB PDB site
Description: Crystal Structure of Zinc-Bound Natrin From Naja atra
Class: toxin
Keywords: natrin, crisp, serine protease, ion channel blocking, cobra, toxin
Deposited on 2010-05-12, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.183
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Natrin-1
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mz8a1, d3mz8a2
  • Chain 'B':
    Compound: Natrin-1
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mz8b1, d3mz8b2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mz8A (A:)
    nvdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnh
    spdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqiv
    wyqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglct
    npctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mz8A (A:)
    vdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhs
    pdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivw
    yqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglctn
    pctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mz8B (B:)
    nvdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnh
    spdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqiv
    wyqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglct
    npctiynkltncdsllkqsscqddwiksncpascfcrnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mz8B (B:)
    vdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhs
    pdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivw
    yqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklgppcgdcpsacdnglctn
    pctiynkltncdsllkqsscqddwiksncpascfcrnkii