PDB entry 3mz6

View 3mz6 on RCSB PDB site
Description: Crystal structure of D101L Fe2+ HDAC8 complexed with M344
Class: hydrolase
Keywords: hydrolase, metallohydrolase, arginase-fold, ferrous
Deposited on 2010-05-11, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: HDAC8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BY41 (Start-376)
      • engineered mutation (100)
      • expression tag (377)
    Domains in SCOPe 2.07: d3mz6a1, d3mz6a2
  • Heterogens: FE2, K, B3N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mz6A (A:)
    meepeepadsgqslvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpk
    vasmeematfhtdaylqhlqkvsqegdddhpdsieyglgylcpategifdyaaaiggati
    taaqclidgmckvainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlh
    hgdgvedafsftskvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdeky
    yqicesvlkevyqafnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatli
    lggggynlantarcwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrneph
    riqqilnyikgnlkhvviegrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mz6A (A:)
    lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
    aylqhlqkvsqegeyglgylcpategifdyaaaiggatitaaqclidgmckvainwsggw
    hhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftskvmtvslh
    kfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpkavv
    lqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantarcwtyltgv
    ilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlkhvvi