PDB entry 3mz5

View 3mz5 on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS L103A at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, cavity, pressure
Deposited on 2010-05-11, released 2011-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (43-44)
      • engineered mutation (96)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.08: d3mz5a_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3mz5A (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvneaavrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >3mz5A (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvneaavrqglakvayvykgnntheqllrkaeaqa
kkeklniws