PDB entry 3mz3

View 3mz3 on RCSB PDB site
Description: Crystal structure of Co2+ HDAC8 complexed with M344
Deposited on 2010-05-11, released 2010-06-23
The last revision was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.204
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: CDA07, HDAC8, HDACL1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Histone deacetylase 8
    Species: Homo sapiens [TaxId:9606]
    Gene: CDA07, HDAC8, HDACL1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CO, K, B3N, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mz3A (A:)
    meepeepadsgqslvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpk
    vasmeematfhtdaylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggati
    taaqclidgmckvainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlh
    hgdgvedafsftskvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdeky
    yqicesvlkevyqafnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatli
    lggggynlantarcwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrneph
    riqqilnyikgnlkhvviegrgshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mz3A (A:)
    lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
    aylqhlqkvsqdsieyglgydcpategifdyaaaiggatitaaqclidgmckvainwsgg
    whhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftskvmtvsl
    hkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpkav
    vlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantarcwtyltg
    vilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlkhvv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mz3B (B:)
    meepeepadsgqslvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpk
    vasmeematfhtdaylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggati
    taaqclidgmckvainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlh
    hgdgvedafsftskvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdeky
    yqicesvlkevyqafnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatli
    lggggynlantarcwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrneph
    riqqilnyikgnlkhvviegrgshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mz3B (B:)
    slvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfht
    daylqhlqkvsqieyglgydcpategifdyaaaiggatitaaqclidgmckvainwsggw
    hhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftskvmtvslh
    kfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpkavv
    lqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantarcwtyltgv
    ilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlkhvv