PDB entry 3mz2

View 3mz2 on RCSB PDB site
Description: crystal structure of a glycerophosphoryl diester phosphodiesterase (bdi_3922) from parabacteroides distasonis atcc 8503 at 1.55 a resolution
Deposited on 2010-05-11, released 2010-07-07
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerophosphoryl diester phosphodiesterase
    Species: Parabacteroides distasonis [TaxId:435591]
    Gene: BDI_3922
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Glycerophosphoryl diester phosphodiesterase
    Species: Parabacteroides distasonis [TaxId:435591]
    Gene: BDI_3922
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, PG4, NA, PE4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mz2A (A:)
    geeleykgmntlqisnvddlisfyqyaddriplisghrggrgkgypensmetfentlsyt
    patfeidprltkdsvivlfhddtlertsngtgkvsdytweelqnfrlkdpegnitnyrip
    tleeairwargktilildkkdvpmertaqlitdmqaepyvmitvhdgasarffyeknpnf
    mfeafvktkeavqdyedngipwshimayvgpkitpevrevidmlhergvmcmistapsdd
    klstpesraeayrmiirqgvdiiesdrpievaeaisslipvssskgkffstl
    

    Sequence, based on observed residues (ATOM records):
    >3mz2A (A:)
    gmntlqisnvddlisfyqyaddriplisghrggrgkgypensmetfentlsytpatfeid
    prltkdsvivlfhddtlertsngtgkvsdytweelqnfrlkdpegnitnyriptleeair
    wargktilildkkdvpmertaqlitdmqaepyvmitvhdgasarffyeknpnfmfeafvk
    tkeavqdyedngipwshimayvgpkitpevrevidmlhergvmcmistapsddklstpes
    raeayrmiirqgvdiiesdrpievaeaisslipvssskgkffstl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mz2B (B:)
    geeleykgmntlqisnvddlisfyqyaddriplisghrggrgkgypensmetfentlsyt
    patfeidprltkdsvivlfhddtlertsngtgkvsdytweelqnfrlkdpegnitnyrip
    tleeairwargktilildkkdvpmertaqlitdmqaepyvmitvhdgasarffyeknpnf
    mfeafvktkeavqdyedngipwshimayvgpkitpevrevidmlhergvmcmistapsdd
    klstpesraeayrmiirqgvdiiesdrpievaeaisslipvssskgkffstl
    

    Sequence, based on observed residues (ATOM records):
    >3mz2B (B:)
    gmntlqisnvddlisfyqyaddriplisghrggrgkgypensmetfentlsytpatfeid
    prltkdsvivlfhddtlertsngtgkvsdytweelqnfrlkdpegnitnyriptleeair
    wargktilildkkdvpmertaqlitdmqaepyvmitvhdgasarffyeknpnfmfeafvk
    tkeavqdyedngipwshimayvgpkitpevrevidmlhergvmcmistapsddklstpes
    raeayrmiirqgvdiiesdrpievaeaisslipvssskgkffstl