PDB entry 3mz1

View 3mz1 on RCSB PDB site
Description: the crystal structure of a possible transcription regulator protein from sinorhizobium meliloti 1021
Deposited on 2010-05-11, released 2010-06-02
The last revision was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R00429, SMc01092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92SG7
      • cloning artifact (216)
  • Chain 'B':
    Compound: Putative transcriptional regulator
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R00429, SMc01092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92SG7
      • cloning artifact (216)
  • Chain 'C':
    Compound: Putative transcriptional regulator
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R00429, SMc01092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92SG7
      • cloning artifact (216)
  • Chain 'D':
    Compound: Putative transcriptional regulator
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R00429, SMc01092
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92SG7
      • cloning artifact (216)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mz1A (A:)
    qgmraflrvvetgnftrasaslnmpkatvtnliqgleahlrtkllnrttrrvlvtpdgal
    yyeraarllsdldeldgslstaqslpkgrlrvetasafanlviipalpefhkkypdiqid
    lgvsdrtidylaenvdcairagtltdqsliarritemkfvacasrdflerhpvpqhpsdl
    ekncyvvgyflpktgqqmpfhfrrgneeievsgrytmaanesttylaaaraglgviqapl
    fmvredlrngtmvpvlpdwqvepmpiylvyppnrhlssrlrvfadwvvkvmaqsqngegs
    

    Sequence, based on observed residues (ATOM records):
    >3mz1A (A:)
    lpkgrlrvetasafanlviipalpefhkkypdiqidlgvsdrtylaenvdcairagtltd
    qsliarritemkfvacasrdflerhpvpqhpsdlekncyvvgyflpkqqmpfhfrrgnee
    ievsgrytmaanesttylaaaraglgviqaplfmvredlrngtmvpvlpdwqvepmpiyl
    vyppnrhlssrlrvfadwvvkvmaqsqn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mz1B (B:)
    qgmraflrvvetgnftrasaslnmpkatvtnliqgleahlrtkllnrttrrvlvtpdgal
    yyeraarllsdldeldgslstaqslpkgrlrvetasafanlviipalpefhkkypdiqid
    lgvsdrtidylaenvdcairagtltdqsliarritemkfvacasrdflerhpvpqhpsdl
    ekncyvvgyflpktgqqmpfhfrrgneeievsgrytmaanesttylaaaraglgviqapl
    fmvredlrngtmvpvlpdwqvepmpiylvyppnrhlssrlrvfadwvvkvmaqsqngegs
    

    Sequence, based on observed residues (ATOM records):
    >3mz1B (B:)
    lpkgrlrvetasafanlviipalpefhkkypdiqidlgvsdrtidylaenvdcairagtl
    tdqsliarritemkfvacasrdflerhpvpqhpsdlekncyvvgyflpktgqqmpfhfrr
    gneeievsgrytmaanesttylaaaraglgviqaplfmvredlrngtmvpvlpdwqvepm
    piylvyppnrhlssrlrvfadwvvkvmaqsqn
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mz1C (C:)
    qgmraflrvvetgnftrasaslnmpkatvtnliqgleahlrtkllnrttrrvlvtpdgal
    yyeraarllsdldeldgslstaqslpkgrlrvetasafanlviipalpefhkkypdiqid
    lgvsdrtidylaenvdcairagtltdqsliarritemkfvacasrdflerhpvpqhpsdl
    ekncyvvgyflpktgqqmpfhfrrgneeievsgrytmaanesttylaaaraglgviqapl
    fmvredlrngtmvpvlpdwqvepmpiylvyppnrhlssrlrvfadwvvkvmaqsqngegs
    

    Sequence, based on observed residues (ATOM records):
    >3mz1C (C:)
    lpkgrlrvetasafanlviipalpefhkkypdiqidlgvsdrylaenvdcairagtslia
    rritemkfvacasrdflerhpvpqhpsdlekncyvvgyflpkqqmpfhfrrgneeievsg
    rytmaanesttylaaaraglgviqaplfmvredlrngtmvpvlpdwqvepmpiylvyppn
    rhlssrlrvfadwvvkvmaqsqng
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mz1D (D:)
    qgmraflrvvetgnftrasaslnmpkatvtnliqgleahlrtkllnrttrrvlvtpdgal
    yyeraarllsdldeldgslstaqslpkgrlrvetasafanlviipalpefhkkypdiqid
    lgvsdrtidylaenvdcairagtltdqsliarritemkfvacasrdflerhpvpqhpsdl
    ekncyvvgyflpktgqqmpfhfrrgneeievsgrytmaanesttylaaaraglgviqapl
    fmvredlrngtmvpvlpdwqvepmpiylvyppnrhlssrlrvfadwvvkvmaqsqngegs
    

    Sequence, based on observed residues (ATOM records):
    >3mz1D (D:)
    lpkgrlrvetasafanlviipalpefhkkypdiqidlgvsdrtidylaenvdcairagtl
    tdqsliarritemkfvacasrdflerhpvpqhpsdlekncyvvgyflpktgqqmpfhfrr
    gneeievsgrytmaanesttylaaaraglgviqaplfmvredlrngtmvpvlpdwqvepm
    piylvyppnrhlssrlrvfadwvvkvmaqsqn