PDB entry 3myx

View 3myx on RCSB PDB site
Description: crystal structure of a pspto_0244 (protein with unknown function which belongs to pfam duf861 family) from pseudomonas syringae pv. tomato str. dc3000 at 1.30 a resolution
Deposited on 2010-05-11, released 2010-06-09
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized protein PSPTO_0244
    Species: Pseudomonas syringae pv. tomato [TaxId:223283]
    Gene: PSPTO0244, PSPTO_0244
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: uncharacterized protein PSPTO_0244
    Species: Pseudomonas syringae pv. tomato [TaxId:223283]
    Gene: PSPTO0244, PSPTO_0244
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3myxA (A:)
    gmpqptvlllaradlspvgtefttgpidahdpfdsgrrtafvdeqgiaagivefgtalsv
    eaypytemlvmhrgsvtltsgtdsvtlstgesavigrgtqvridaqpeslwafcastqas
    gpdksgitaldrlalltpssppdpsimisplpqcrsnnlfedtastlrigvwdstpyeri
    srphkihelmnliegrvvlslengssltvntgdtvfvaqgapckwtstgyvrkfyavt
    

    Sequence, based on observed residues (ATOM records):
    >3myxA (A:)
    qptvlllaradlspvgtefttgpidahdpfdsgrrtafvdeqgiaagivefgtalsveay
    pytemlvmhrgsvtltsgtdsvtlstgesavigrgtqvridaqpeslwafcastqasgpd
    ksgitaldrlalltpssppdpsimisplpqcrsnnlfedtastlrigvwdstpyerisrp
    hkihelmnliegrvvlslengssltvntgdtvfvaqgapckwtstgyvrkfyavt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3myxB (B:)
    gmpqptvlllaradlspvgtefttgpidahdpfdsgrrtafvdeqgiaagivefgtalsv
    eaypytemlvmhrgsvtltsgtdsvtlstgesavigrgtqvridaqpeslwafcastqas
    gpdksgitaldrlalltpssppdpsimisplpqcrsnnlfedtastlrigvwdstpyeri
    srphkihelmnliegrvvlslengssltvntgdtvfvaqgapckwtstgyvrkfyavt
    

    Sequence, based on observed residues (ATOM records):
    >3myxB (B:)
    qptvlllaradlspvgtefttgpidahdpfdsgrrtafvdeqgiaagivefgtalsveay
    pytemlvmhrgsvtltsgtdsvtlstgesavigrgtqvridaqpeslwafcastqasgpd
    ksgitaldrlalltpssppdpsimisplpqcrsnnlfedtastlrigvwdstpyerisrp
    hkihelmnliegrvvlslengssltvntgdtvfvaqgapckwtstgyvrkfyavt