PDB entry 3myw

View 3myw on RCSB PDB site
Description: The Bowman-Birk type inhibitor from mung bean in ternary complex with porcine trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: serine proteinase, Bowman-Birk-type inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-05-11, released 2010-12-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00761 (0-222)
      • variant (11)
      • see remark 999 (150)
    Domains in SCOPe 2.01: d3mywa_
  • Chain 'B':
    Compound: Trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00761 (0-222)
      • variant (11)
      • see remark 999 (150)
  • Chain 'I':
    Compound: Bowman-Birk type trypsin inhibitor
    Species: Vigna radiata var. radiata [TaxId:3916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01062
      • see remark 999 (21)
      • see remark 999 (24)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mywA (A:)
    ivggytcaansvpyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
    neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
    wgntkssgssypsllqclkapvlsdsscksaypgqitgnmicvgfleggkdscqgdsggp
    vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
    

  • Chain 'B':
    No sequence available.

  • Chain 'I':
    No sequence available.