PDB entry 3myv

View 3myv on RCSB PDB site
Description: crystal structure of a susd superfamily protein (bvu_0732) from bacteroides vulgatus atcc 8482 at 1.80 a resolution
Deposited on 2010-05-11, released 2010-06-02
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SusD superfamily protein
    Species: Bacteroides vulgatus [TaxId:435590]
    Gene: BVU_0732
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SusD superfamily protein
    Species: Bacteroides vulgatus [TaxId:435590]
    Gene: BVU_0732
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, EDO, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3myvA (A:)
    gnkipttmafrtvtdvdnavnglydlmsgsgyygaamfaygdmkgddmqsseesgvcntc
    ymfnhrpnslnagslwgrpfyilreawnilnaiaegkiesgdekklnalkgetmavialc
    qfdltrcfgypytkdkgaslgaplidhlvgtyenpprstvaqaydfiietleeavtlmse
    eknngrmnkyaarallariylyhddnrkafdladqlikdadtsgsyalyphekyvaawsv
    eakfgsesffeiansvddtpgrdswgyllnwygyqkgfvtqkyaeqmladpgdvrghlle
    enkyagktvwwlyklrgtdlktaplecnnvvlrlsevyliaaeagcklggdaavqglgyl
    neivkrgnpdnevtmadytldrvlderskelvgeghrffdllrngktivrkggyhlpsvd
    eevdwdfykcvlpipedqfifspemeqnpgypkn
    

    Sequence, based on observed residues (ATOM records):
    >3myvA (A:)
    frtvtdvdnavnglydlmsgsgyygaamfaygdmkgddmqsseesgvcntcymfnhrpns
    lnagslwgrpfyilreawnilnaiaegkiesgdekklnalkgetmavialcqfdltrcfg
    ypytkdkgaslgaplidhlvgtyenpprstvaqaydfiietleeavtlmseeknngrmnk
    yaarallariylyhddnrkafdladqlikdadtsgsyalyphekyvaawsveakfgsesf
    feiansvddtpgrdswgyllnwygyqkgfvtqkyaeqmladpgdvrghlleenkyagktv
    wwlyklrgtdlktaplecnnvvlrlsevyliaaeagcklggdaavqglgylneivkrgnp
    dnevtmadytldrvlderskelvgeghrffdllrngktivrkggyhlpsvdeevdwdfyk
    cvlpipedqfifspemeqnpgypkn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3myvB (B:)
    gnkipttmafrtvtdvdnavnglydlmsgsgyygaamfaygdmkgddmqsseesgvcntc
    ymfnhrpnslnagslwgrpfyilreawnilnaiaegkiesgdekklnalkgetmavialc
    qfdltrcfgypytkdkgaslgaplidhlvgtyenpprstvaqaydfiietleeavtlmse
    eknngrmnkyaarallariylyhddnrkafdladqlikdadtsgsyalyphekyvaawsv
    eakfgsesffeiansvddtpgrdswgyllnwygyqkgfvtqkyaeqmladpgdvrghlle
    enkyagktvwwlyklrgtdlktaplecnnvvlrlsevyliaaeagcklggdaavqglgyl
    neivkrgnpdnevtmadytldrvlderskelvgeghrffdllrngktivrkggyhlpsvd
    eevdwdfykcvlpipedqfifspemeqnpgypkn
    

    Sequence, based on observed residues (ATOM records):
    >3myvB (B:)
    frtvtdvdnavnglydlmsgsgyygaamfaygdmkgddmqsseesgvcntcymfnhrpns
    lnagslwgrpfyilreawnilnaiaegkiesgdekklnalkgetmavialcqfdltrcfg
    ypytkdkgaslgaplidhlvgtyenpprstvaqaydfiietleeavtlmseeknngrmnk
    yaarallariylyhddnrkafdladqlikdadtsgsyalyphekyvaawsveakfgsesf
    feiansvddtpgrdswgyllnwygyqkgfvtqkyaeqmladpgdvrghlleenkyagktv
    wwlyklrgtdlktaplecnnvvlrlsevyliaaeagcklggdaavqglgylneivkrgnp
    dnevtmadytldrvlderskelvgeghrffdllrngktivrkggyhlpsvdeevdwdfyk
    cvlpipedqfifspemeqnpgypk