PDB entry 3myu

View 3myu on RCSB PDB site
Description: mycoplasma genitalium mg289
Deposited on 2010-05-11, released 2010-10-20
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.222
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High affinity transport system protein p37
    Species: Mycoplasma genitalium [TaxId:2097]
    Gene: MG289, p37
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: High affinity transport system protein p37
    Species: Mycoplasma genitalium [TaxId:2097]
    Gene: MG289, p37
    Database cross-references and differences (RAF-indexed):
  • Heterogens: VIB, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3myuA (A:)
    mcatksdntlifnisldhnadtsiekfftvfskklsgklnkkinvnfnivddsftkinni
    qankadfafvnsqaiasnnwfgytpliqtlttafkedleldyyedgnlqkkaektnllfl
    sppykewddikqkwtgnrydflyepsklvsfyrsmilitgsaseitaikkawneknwnqf
    mkfgighgqtnsasrfelpdllfrkhfaknypglqnainsdpdkfavvrgreiginknik
    ivfddansfswtqnikgskrpfytpidpndrleiltysdpllydigivsnnlsriyqkai
    geifielaqssedlygpsigyngykmindfekevveiiektygk
    

    Sequence, based on observed residues (ATOM records):
    >3myuA (A:)
    ntlifnisldhnadtsiekfftvfskklsgklnkkinvnfnivddsftkinniqankadf
    afvnsqaiasnnwfgytpliqtlttafkedleldyyedgnlqkkaektnllflsppykew
    ddikqkwtgnrydflyepsklvsfyrsmilitgsaseitaikkawneknwnqfmkfgigh
    gqtnsasrfelpdllfrkhfaknypglqnainsdpdkfavvrgreiginknikivfddan
    sfswtqnikrpfytpidpndrleiltysdpllydigivsnnlsriyqkaigeifielaqs
    sedlygpsigyngykmindfekevveiiektyg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3myuB (B:)
    mcatksdntlifnisldhnadtsiekfftvfskklsgklnkkinvnfnivddsftkinni
    qankadfafvnsqaiasnnwfgytpliqtlttafkedleldyyedgnlqkkaektnllfl
    sppykewddikqkwtgnrydflyepsklvsfyrsmilitgsaseitaikkawneknwnqf
    mkfgighgqtnsasrfelpdllfrkhfaknypglqnainsdpdkfavvrgreiginknik
    ivfddansfswtqnikgskrpfytpidpndrleiltysdpllydigivsnnlsriyqkai
    geifielaqssedlygpsigyngykmindfekevveiiektygk
    

    Sequence, based on observed residues (ATOM records):
    >3myuB (B:)
    ntlifnisldhnadtsiekfftvfskklsgklnkkinvnfnivddsftkinniqankadf
    afvnsqaiasnnwfgytpliqtlttafkedleldyyedgnlqkkaektnllflsppykew
    ddikqkwtgnrydflyepsklvsfyrsmilitgsaseitaikkawneknwnqfmkfgigh
    gqtnsasrfelpdllfrkhfaknypglqnainsdpdkfavvrgreiginknikivfddan
    sfswtqnikkrpfytpidpndrleiltysdpllydigivsnnlsriyqkaigeifielaq
    ssedlygpsigyngykmindfekevveiiektyg