PDB entry 3myt

View 3myt on RCSB PDB site
Description: Crystal structure of Ketosteroid Isomerase D38HD99N from Pseudomonas testosteroni (tKSI)
Class: isomerase
Keywords: ISOMERASE, lipid metabolism, steroid metabolism
Deposited on 2010-05-11, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-End)
      • engineered mutation (37)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d3myta_
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (37)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d3mytb_
  • Chain 'C':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (37)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d3mytc_
  • Chain 'D':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-End)
      • engineered mutation (37)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d3mytd_
  • Heterogens: SO4, EQU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mytA (A:)
    mntpehmtavvqryvaalnagdldgivalfaddatvehpvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mytA (A:)
    mntpehmtavvqryvaalnagdldgivalfaddatvehpvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mytB (B:)
    mntpehmtavvqryvaalnagdldgivalfaddatvehpvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mytC (C:)
    mntpehmtavvqryvaalnagdldgivalfaddatvehpvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mytD (D:)
    mntpehmtavvqryvaalnagdldgivalfaddatvehpvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mytD (D:)
    mntpehmtavvqryvaalnagdldgivalfaddatvehpvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihag