PDB entry 3myp

View 3myp on RCSB PDB site
Description: Crystal structure of tagatose-1,6-bisphosphate aldolase from Staphylococcus aureus
Deposited on 2010-05-10, released 2011-01-26
The last revision was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.205
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tagatose 1,6-diphosphate aldolase
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: lacD, SACOL2183
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Tagatose 1,6-diphosphate aldolase
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: lacD, SACOL2183
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Tagatose 1,6-diphosphate aldolase
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: lacD, SACOL2183
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Tagatose 1,6-diphosphate aldolase
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: lacD, SACOL2183
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mypA (A:)
    msksnqkiasieqlsnnegiisalafdqrgalkrmmakhqteeptvaqieqlkvlvaeel
    tqyassilldpeyglpasdarnkdcglllayektgydvnakgrlpdclvewsakrlkeqg
    anavkfllyydvddaeeiniqkkayierigsecvaedipfflevltyddnipdngsvefa
    kvkprkvneamklfseprfnvdvlkvevpvnmkyvegfaegevvytkeeaaqhfkdqdaa
    thlpyiylsagvsaelfqetlkfaheagakfngvlcgratwsgavqvyieqgedaarewl
    rttgfkniddlnkvlkdtatswkqrklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mypA (A:)
    snqkiasieqlsnnegiisalafdqrgalkrmmakhqteeptvaqieqlkvlvaeeltqy
    assilldpeyglpasdarnkdcglllayektgydvnakgrlpdclvewsakrlkeqgana
    vkfllyydvddaeeiniqkkayierigsecvaedipfflevltyddnipdngsvefakvk
    prkvneamklfseprfnvdvlkvevpvnmkyvegfaegevvytkeeaaqhfkdqdaathl
    pyiylsagvsaelfqetlkfaheagakfngvlcgratwsgavqvyieqgedaarewlrtt
    gfkniddlnkvlkdtatswkq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mypB (B:)
    msksnqkiasieqlsnnegiisalafdqrgalkrmmakhqteeptvaqieqlkvlvaeel
    tqyassilldpeyglpasdarnkdcglllayektgydvnakgrlpdclvewsakrlkeqg
    anavkfllyydvddaeeiniqkkayierigsecvaedipfflevltyddnipdngsvefa
    kvkprkvneamklfseprfnvdvlkvevpvnmkyvegfaegevvytkeeaaqhfkdqdaa
    thlpyiylsagvsaelfqetlkfaheagakfngvlcgratwsgavqvyieqgedaarewl
    rttgfkniddlnkvlkdtatswkqrklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mypB (B:)
    snqkiasieqlsnnegiisalafdqrgalkrmmakhqteeptvaqieqlkvlvaeeltqy
    assilldpeyglpasdarnkdcglllayektgydvnakgrlpdclvewsakrlkeqgana
    vkfllyydvddaeeiniqkkayierigsecvaedipfflevltyddnipdngsvefakvk
    prkvneamklfseprfnvdvlkvevpvnmkyvegfaegevvytkeeaaqhfkdqdaathl
    pyiylsagvsaelfqetlkfaheagakfngvlcgratwsgavqvyieqgedaarewlrtt
    gfkniddlnkvlkdtatswkq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mypC (C:)
    msksnqkiasieqlsnnegiisalafdqrgalkrmmakhqteeptvaqieqlkvlvaeel
    tqyassilldpeyglpasdarnkdcglllayektgydvnakgrlpdclvewsakrlkeqg
    anavkfllyydvddaeeiniqkkayierigsecvaedipfflevltyddnipdngsvefa
    kvkprkvneamklfseprfnvdvlkvevpvnmkyvegfaegevvytkeeaaqhfkdqdaa
    thlpyiylsagvsaelfqetlkfaheagakfngvlcgratwsgavqvyieqgedaarewl
    rttgfkniddlnkvlkdtatswkqrklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mypC (C:)
    snqkiasieqlsnnegiisalafdqrgalkrmmakhqteeptvaqieqlkvlvaeeltqy
    assilldpeyglpasdarnkdcglllayektgydvnakgrlpdclvewsakrlkeqgana
    vkfllyydvddaeeiniqkkayierigsecvaedipfflevltyddnipdngsvefakvk
    prkvneamklfseprfnvdvlkvevpvnmkyvegfaegevvytkeeaaqhfkdqdaathl
    pyiylsagvsaelfqetlkfaheagakfngvlcgratwsgavqvyieqgedaarewlrtt
    gfkniddlnkvlkdtatswkq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mypD (D:)
    msksnqkiasieqlsnnegiisalafdqrgalkrmmakhqteeptvaqieqlkvlvaeel
    tqyassilldpeyglpasdarnkdcglllayektgydvnakgrlpdclvewsakrlkeqg
    anavkfllyydvddaeeiniqkkayierigsecvaedipfflevltyddnipdngsvefa
    kvkprkvneamklfseprfnvdvlkvevpvnmkyvegfaegevvytkeeaaqhfkdqdaa
    thlpyiylsagvsaelfqetlkfaheagakfngvlcgratwsgavqvyieqgedaarewl
    rttgfkniddlnkvlkdtatswkqrklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mypD (D:)
    snqkiasieqlsnnegiisalafdqrgalkrmmakhqteeptvaqieqlkvlvaeeltqy
    assilldpeyglpasdarnkdcglllayektgydvnakgrlpdclvewsakrlkeqgana
    vkfllyydvddaeeiniqkkayierigsecvaedipfflevltyddnipdngsvefakvk
    prkvneamklfseprfnvdvlkvevpvnmkyvegfaegevvytkeeaaqhfkdqdaathl
    pyiylsagvsaelfqetlkfaheagakfngvlcgratwsgavqvyieqgedaarewlrtt
    gfkniddlnkvlkdtatswkq