PDB entry 3myo

View 3myo on RCSB PDB site
Description: Crystal structure of tagatose-1,6-bisphosphate aldolase from Streptococcus pyogenes
Deposited on 2010-05-10, released 2011-01-26
The last revision was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tagatose 1,6-diphosphate aldolase 1
    Species: Streptococcus pyogenes [TaxId:301447]
    Gene: LACD.1, LACD1, SPY_1704, M5005_SPY1395
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63703 (Start-324)
      • expression tag (325-328)
  • Chain 'B':
    Compound: Tagatose 1,6-diphosphate aldolase 1
    Species: Streptococcus pyogenes [TaxId:301447]
    Gene: LACD.1, LACD1, SPY_1704, M5005_SPY1395
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63703 (Start-324)
      • expression tag (325-328)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3myoA (A:)
    mtitankrhylekvshqgiisalafdqrgalkqmmaahqegeatvtqietlkvlvseelt
    pyassilldpeygllatkvranqtglllayektgydatttsrlpdclvewsvkrlkaaga
    daikfllyydvdgdeqinlqkqayierigsectaedipfflellsyderisdnnsaayak
    lkphkvngamsvfsdkrfgvdvlkvevpvnmayvegftegevhysqaeaikafqdqeaas
    hlpyiylsagvsaklfqetlyfaaaagaqfsgvlcgratwagsvpvyitkgedearkwlc
    tegfqnidelnrvleetaspwtekilehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3myoA (A:)
    titankrhylekvshqgiisalafdqrgalkqmmaahqegeatvtqietlkvlvseeltp
    yassilldpeygllatkvranqtglllayektgydatttsrlpdclvewsvkrlkaagad
    aikfllyydvdgdeqinlqkqayierigsectaedipfflellsyderisdnnsaayakl
    kphkvngamsvfsdkrfgvdvlkvevpvnmayvegftegevhysqaeaikafqdqeaash
    lpyiylsagvsaklfqetlyfaaaagaqfsgvlcgratwagsvpvyitkgedearkwlct
    egfqnidelnrvleetaspwtekilehh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3myoB (B:)
    mtitankrhylekvshqgiisalafdqrgalkqmmaahqegeatvtqietlkvlvseelt
    pyassilldpeygllatkvranqtglllayektgydatttsrlpdclvewsvkrlkaaga
    daikfllyydvdgdeqinlqkqayierigsectaedipfflellsyderisdnnsaayak
    lkphkvngamsvfsdkrfgvdvlkvevpvnmayvegftegevhysqaeaikafqdqeaas
    hlpyiylsagvsaklfqetlyfaaaagaqfsgvlcgratwagsvpvyitkgedearkwlc
    tegfqnidelnrvleetaspwtekilehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3myoB (B:)
    titankrhylekvshqgiisalafdqrgalkqmmaahqegeatvtqietlkvlvseeltp
    yassilldpeygllatkvranqtglllayektgydatttsrlpdclvewsvkrlkaagad
    aikfllyydvdgdeqinlqkqayierigsectaedipfflellsyderisdnnsaayakl
    kphkvngamsvfsdkrfgvdvlkvevpvnmayvegftegevhysqaeaikafqdqeaash
    lpyiylsagvsaklfqetlyfaaaagaqfsgvlcgratwagsvpvyitkgedearkwlct
    egfqnidelnrvleetaspwtekilehh