PDB entry 3mym

View 3mym on RCSB PDB site
Description: Mutation of Methionine-86 in Dehaloperoxidase-hemoglobin: Effects of the Asp-His-Fe Triad in a 3/3 Globin
Class: oxidoreductase
Keywords: peroxidase, globin, dehaloperoxidase-hemoglobin, OXIDOREDUCTASE
Deposited on 2010-05-10, released 2011-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.186
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • engineered mutation (85)
    Domains in SCOPe 2.07: d3myma_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • engineered mutation (85)
    Domains in SCOPe 2.07: d3mymb_
  • Heterogens: HEM, CYN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mymA (A:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqekqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mymB (B:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdantlvqekqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk